ORFeome > mdk – XORFeome 2.0

mdk – XORFeome 2.0

General Information

Species: Xenopus tropicalis midkine (neurite growth-promoting factor 2), mRNA (cDNA clone MGC:75716 IMAGE:5380807), complete cds
Gene Symbol: mdk
Gene ID: 394671
ORF gb_acc: MG132978
ORF ID: 10356

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061275

Library Location

Plate ID: GDExt11004
Well Location: B05

EST Sequences

Clone: MGC:75716 IMAGE:5380807
Trimmed Sequence: ATGGAATTACGAGCATTTTGTGTCATTCTCTTGATCACGTTCCTCGCCGTGAGCTCCCAAGCAGCAAAGAACAAAAAAGAGAAGGGGAAGAAGGGGGCGTCTGACTGCACAGAATGGACCTGGGGGCGCTGTATCCCCAATAGCAAAGACTGCGGAGCAGGAACTCGGGAGGGAACATGCAAAGAGGAGACCCGCAAGCTGAAGTGCAAGATTCCCTGCAACTGGAAGAAAGCCTTTGGGGCTGACTGCAAGTACAAATTTGAGAACTGGGGAGAGTGTAATGCCACCACTGGCCAGAAGGTGCGCTCTGGAACCCTAAAGAAGGCTTTGTATAATGCCGACTGCCAGCAAACCGTGGAAGCCACTAAGCCCTGCTCCCTCAAAACCAAGTCCAAATCCAAAGGCAAGAAAGGCAAAGGGAAGGAGTAG
Full Trace Sequence: gaagataaggagagaagtgcaggcacccaaggctgctggccgttcctgctgaaacccactgcccacattcaggctccctcctctgaggtgtgagatacaagcaaggcaccacgcaggcaggcaggatggaattacgagcattttgtgtcattctcttgatcacgttcctcgccgtgagctcccaagcagcaaagaacaaaaaagagaaggggaagaagggggcgtctgactgcacagaatggacctgggggcgctgtatccccaatagcaaagactgcggagcaggaactcgggagggaacatgcaaagaggagacccgcaagctgaagtgcaagattccctgcaactggaagaaagcctttggggctgactgcaagtacaaatttgagaactggggagagtgtaatgccaccactggccagaaggtgcgctctggaaccctaaagaaggctttgtataatgccgactgccagcaaaccgtggaagccactaagccctgctccctcaaaaccaagtccaaatccaaaggcaagaaaggcaaagggaaggagtagaagagcagagaagcattagccggaccattttctgcagcctgcactcctgtctcacccccggcccctgtttgtcatggaattcccttctttacaatctgtctccaaaatgcactctctctgcccccctacaacccacccccacccccctgagactgacgttttttaatcactaatttttttaggaaaaaaaaaaagaaaaaggaatctaagagaaaaaaaaagcagccactccgactccccaggcgccactctataaaccactatgctccccccttctccccatgcgtttgtggcttgttatatttctgtattttttaggaggattccttttgaatttgctttttttttaataaatgtacagtttgaatttgtaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MELRAFCVILLITFLAVSSQAAKNKKEKGKKGASDCTEWTWGRCIPNSKDCGAGTREGTCKEETRKLKCKIPCNWKKAFGADCKYKFENWGECNATTGQKVRSGTLKKALYNADCQQTVEATKPCSLKTKSKSKGKKGKGKE
Donor tissue: tadpole