ORFeome > MGC69199 – XORFeome 2.0

MGC69199 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC69199 protein, mRNA (cDNA clone MGC:69199 IMAGE:5307395), complete cds
Gene Symbol: MGC69199
Gene ID: 448099
ORF gb_acc: MG133256
ORF ID: 10739

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC074629

Library Location

Plate ID: GDExt11007
Well Location: C05

EST Sequences

Clone: MGC:69199 IMAGE:5307395
Trimmed Sequence: ATGGTGAAGATTGCATTCAGTTCGCCCTTCGCGGGCAAAAAGCCCAGCAAGGATGTGGAGGCTTTGGTGGCTGAAACGGATACTGAAGTTGCTGCTCAAGGGACCGAAAATTCAACTGGAAGATGCCTGCTAACTCTTTTGGGTCTTGCTTTCATTTTAGCTGGGCTGATAGTTGGCGGTGCTTGCATCTATAAATACTTTATGCCCAGGCGCAATATCTATGAAGGAGTAATGTCTTATTCAGAGCAGCATGATCTTGGTGAGGAGCCTTATTACCTTCCTGTCTCAGAAGAAGCTGACATCAGAGAAGATGACAATGTTGCACTGATTACTGTTCCTGTACCAAGTTTTTCAGAGAGTGATCCAGCAGCTATACTTCATGATTTTGATAGACTTCTGACAGCCTACTTGGACTTGCAGCTCCAAAAATGCTATGTCATTGATTTGAACACCTCCATTGTCATGCCACCAAGAAACCTGCTGGATTTGTTCATTAAACTGGCTGATGGATCCTTTTTGCCTCAGACCTATTTAGTCCAGGAAGATCTAATCGTGTCAGAGAAAATCGATGATTTGTCCGAACTGGGTATTTTTATTTACCAGCACTGTGTTGGAAGAGAGACATATAGGCTGGTTCGCAGAGATCAAATAATTGGTCTGCAAAAGAGGTCTGTACAAGATTGCTTTACAATTAATCACTTTGAAAATAACTTTGTGACATCAACAAAGATTTGCAAGAATTAA
Full Trace Sequence: gttaagggctggggagaaggaggagctgcgcttgttgttagtgcgtcagaagcagctgtataggcgctacagacaggagactgctctggaagtcagacaccatggtgaagattgcattcagttcgcccttcgcgggcaaaaagcccagcaaggatgtggaggctttggtggctgaaacggatactgaagttgctgctcaagggaccgaaaattcaactggaagatgcctgctaactcttttgggtcttgctttcattttagctgggctgatagttggcggtgcttgcatctataaatactttatgcccaggcgcaatatctatgaaggagtaatgtcttattcagagcagcatgatcttggtgaggagccttattaccttcctgtctcagaagaagctgacatcagagaagatgacaatgttgcactgattactgttcctgtaccaagtttttcagagagtgatccagcagctatacttcatgattttgatagacttctgacagcctacttggacttgcagctccaaaaatgctatgtcattgatttgaacacctccattgtcatgccaccaagaaacctgctggatttgttcattaaactggctgatggatcctttttgcctcagacctatttagtccaggaagatctaatcgtgtcagagaaaatcgatgatttgtccgaactgggtatttttatttaccagcactgtgttggaagagagacatataggctggttcgcagagatcaaataattggtctgcaaaagaggtctgtacaagattgctttacaattaatcactttgaaaataactttgtgacatcaacaaagatttgcaagaattaaacgacttgagatctcgcataatcactagagaagtcttgctgttctcataaaaaatgtgcattgataatcaaaagaattagtcctggtgcatagctgtgtgctaccactttctgttgtatttccctgtgagagtcactatgggtattagcctgtatcttaaaaaactgagagattgcaggtattaggagaggtgcatttgcactactaatataagatttttgtccaaataattgcagattagagagaacatcagagaccctgccgttttaaatcacttaagatacagtttgagacccttttcacagtaagaggtttgttaaagttaaacctctgaatttgtctttgaaataattagacaatacaaaagagaaaaaaattatttcacttcactgacttgtaaagtcactttcttctttagatggtggatgcaataaagtgtgttctttgcacaaactctttaaatctaaaaaaaaaaaaaaaaaaaaaaa
Translation: MVKIAFSSPFAGKKPSKDVEALVAETDTEVAAQGTENSTGRCLLTLLGLAFILAGLIVGGACIYKYFMPRRNIYEGVMSYSEQHDLGEEPYYLPVSEEADIREDDNVALITVPVPSFSESDPAAILHDFDRLLTAYLDLQLQKCYVIDLNTSIVMPPRNLLDLFIKLADGSFLPQTYLVQEDLIVSEKIDDLSELGIFIYQHCVGRETYRLVRRDQIIGLQKRSVQDCFTINHFENNFVTSTKICKN
Donor tissue: gastrula