ORFeome > MGC69363 – XORFeome 2.0

MGC69363 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC69363 protein, mRNA (cDNA clone MGC:69363 IMAGE:5309381), complete cds
Gene Symbol: MGC69363
Gene ID: 448152
ORF gb_acc: MG133312
ORF ID: 10809

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC074687

Library Location

Plate ID: GDExt11008
Well Location: E02

EST Sequences

Clone: MGC:69363 IMAGE:5309381
Trimmed Sequence: ATGGGCTCCAGGGCGTCAACTTTGCTCAGGGATGAGGAGATAGAAGAGATAAAGAAAGAGACGGGTTTTTCTCACAGCCAGATAACTCGATTGTATAGTCGGTTCACAAGCCTGGATAAAGGAGAAAATGGGACTTTAAGTCGAGAAGATTTCCAGCGGATACCAGAGTTGGCTATCAACCCTCTTGGAGATAGAATTATCAATGCTTTCTTCACTGAAGGAGAGGACCAAGTGAATTTCCGAGGCTTCATGAGGACTTTGGCACACTTCCGCCCAATTGAAGATAATTCAAAAGATGCAAACAGTCAAGAGCCACTGAATAGCAGAAGCAACAAATTGTTATTTGCGTTTCGTCTCTATGACTTGGACAAAGATGACAAGATCTCTAGGGAGGAGCTATTACAGGTCCTGCGCATGATGGTGGGGGTGAACATATCAGATGATCAGCTGGGTAGCATCGCTGACCGCACTATACAGGAAGCTGACCAAGATGGAGACAGTGCCATATCATTCACAGAGTTTGTTAAGGTTTTAGAAAAAGTTGATGTAGAACAGAAAATGAGCATCCGTTTCCTACATTGA
Full Trace Sequence: cgccgtaggaaggaagtgagtaaagcgaactatgggctccagggcgtcaactttgctcagggatgaggagatagaagagataaagaaagagacgggtttttctcacagccagataactcgattgtatagtcggttcacaagcctggataaaggagaaaatgggactttaagtcgagaagatttccagcggataccagagttggctatcaaccctcttggagatagaattatcaatgctttcttcactgaaggagaggaccaagtgaatttccgaggcttcatgaggactttggcacacttccgcccaattgaagataattcaaaagatgcaaacagtcaagagccactgaatagcagaagcaacaaattgttatttgcgtttcgtctctatgacttggacaaagatgacaagatctctagggaggagctattacaggtcctgcgcatgatggtgggggtgaacatatcagatgatcagctgggtagcatcgctgaccgcactatacaggaagctgaccaagatggagacagtgccatatcattcacagagtttgttaaggttttagaaaaagttgatgtagaacagaaaatgagcatccgtttcctacattgagcagacaataattcaacttgttgaatatcaggaataagctctttgaccctgcagcaatccaagttgaaccttttcccatttaaaccacactacttgttcattgtgagaggaaaagcacagtggaattaaagagagcagtgctgctgtcatacaattatatttatatatttcttgctttttttgtcttcaatgcaacattctttaagaccatggacagtaatagcattgattgcagaattgtattcagtgcgtatggtgtaagacagggatgccttacttatggcctatggctgtcagggatggtgtaaattatagtttagcatctggggcccccacaggttagacgtaatcaacgtggccttgttgatgggcctttgctctgtggatatcttgcataaatgcaccaagagccttttaaacaatgtaaagagtataggaaaattctatgccataatcttaagaatctgtctgctttgggacagatttttttttttctttttgatggggatattcagataatccgtgtaaagagttgctgtaaaatagtttgtctaaattatacaatatgtaattgttttaagcagagttgatgactttatttaaaaaaaaaaccaaagttaactctgttctgacattaaataaatgaccattctggaccaagaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MGSRASTLLRDEEIEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFTEGEDQVNFRGFMRTLAHFRPIEDNSKDANSQEPLNSRSNKLLFAFRLYDLDKDDKISREELLQVLRMMVGVNISDDQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH
Donor tissue: gastrula