ORFeome > MGC69405 – XORFeome 2.0

MGC69405 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC69405, mRNA (cDNA clone MGC:69405 IMAGE:5335426), complete cds
Gene Symbol: MGC69405
Gene ID: 431674
ORF gb_acc: MG133277
ORF ID: 10762

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC067964

Library Location

Plate ID: GDExt11008
Well Location: A03

EST Sequences

Clone: MGC:69405 IMAGE:5335426
Trimmed Sequence: ATGGCCATTATGGGAGTGCAGATGGTGGTCACATTGTTAGTGGCAAGTATTATGCAGCGGGTGTCTCCTCACTACTCCTTTGGCAGATGGTTGCTGTGTAATGGCAGTTTGTTTCGTTTCAAACATCCAACTGAGGAGGAACTGCGGACTTTAGCTGGGAAACAAAAACCTAAAGCCAAAAGAGAAAGGCGGACAAATGGGGTGACCGATGAGAAACCGCTAACTGTCCCCAAGGACATAGACTTACGCTTGGATACACAGCCAATCACCACCATTGATGCCCTCGGCTTGGCCAGTGTCTGTCACAATCTAGAAAACTTTCTGGCACAGCGAGGCTGGCAGTGGTCAATGCCCTTTGTAAAACTTGCATTTAAAATTGCACTGGTAGCCCTCTGTGCATTCCTCGGTGGCTGCCTCACTTTTCCTGGTTTGCGACTGGCTCAGACTCACTTGGATGCTTTAAAAATGGCAGCTGACAGGCCAATGCTCCAGCTTTTACTTCACATGAGTTTCCTGCCACCTGTTATTGTGGTGGTGCTATGGATTCGTCCAATCACCAGAGACTTTCTGCTAAATGCACCAATGGGAAAGGAGTCTGTAGAGCTGATGTCTAACTCTGCCTACAATACCTTCCGTCTTTGGATAATTGTGGTTCTCTGCCTTCTTCGCTTCTGCTTGACCCGCTTCCATTTGCAGGCATACTTGTGCCTTGCTGACCGCTGGGTGGAACAAATGAAGCGAGAAGCAGGACGCATCTCCATGCTTGAGATACAGCGCAAGATTTCACGCATCTTCTGTTATCTGACTGTGGTTGCTCTTCAGTACCTAGCTCCAATTGTCCTCACTTTTCACTGTGTTTTAATGCTGAAATCATTAGGTGACTATTCTTGGGGACTGTATCCAGAACCCACCGGTTTCACTCCAGTAGTAGATTCTTCTCCTGTGCAGTCACATTCACCTACTTCAGAAGAAGAGGAAGATACTGAAGATGTCCAAGCTGCTGTGGAGCAAATAATGGGAGCGATGTCTTCCTTACGAGGCCTATTTACACCTTTGTTTTTCCGTGGACTCTTTTCATTTCTGACGTGGTGGGTATCCGTCTGCCAGATCGTAACCAGCTTGTTTGGTCTGTACTTTCATCAGTACCTGGGTGCTTCATAG
Full Trace Sequence: ctttcaagcaggactgacttactgaacagtaatcatggccattatgggagtgcagatggtggtcacattgttagtggcaagtattatgcagcgggtgtctcctcactactcctttggcagatggttgctgtgtaatggcagtttgtttcgtttcaaacatccaactgaggaggaactgcggactttagctgggaaacaaaaacctaaagccaaaagagaaaggcggacaaatggggtgaccgatgagaaaccgctaactgtccccaaggacatagacttacgcttggatacacagccaatcaccaccattgatgccctcggcttggccagtgtctgtcacaatctagaaaactttctggcacagcgaggctggcagtggtcaatgccctttgtaaaacttgcatttaaaattgcactggtagccctctgtgcattcctcggtggctgcctcacttttcctggtttgcgactggctcagactcacttggatgctttaaaaatggcagctgacaggccaatgctccagcttttacttcacatgagtttcctgccacctgttattgtggtggtgctatggattcgtccaatcaccagagactttctgctaaatgcaccaatgggaaaggagtctgtagagctgatgtctaactctgcctacaataccttccgtctttggataattgtggttctctgccttcttcgcttctgcttgacccgcttccatttgcaggcatacttgtgccttgctgaccgctgggtggaacaaatgaagcgagaagcaggacgcatctccatgcttgagatacagcgcaagatttcacgcatcttctgttatctgactgtggttgctcttcagtacctagctccaattgtcctcacttttcactgtgttttaatgctgaaatcattaggtgactattcttggggactgtatccagaacccaccggtttcactccagtagtagattcttctcctgtgcagtcacattcacctacttcagaagaagaggaagatactgaagatgtccaagctgctgtggagcaaataatgggagcgatgtcttccttacgaggcctatttacacctttgtttttccgtggactcttttcatttctgacgtggtgggtatccgtctgccagatcgtaaccagcttgtttggtctgtactttcatcagtacctgggtgcttcatagagccaagtagaaagttttcagcaaagaggggacagctggtgaatttactcggagttacaatggtaacaatcttcttgaaacactataggtgcacatacaatcaaatgcttttttctagagaccacatgacctgcaccatgctcaaaagtgaccaccataattgaaatataattgctagatattatttatagaattacattaccagtataataattaacaaattttgttggaaacagctattggttgacaattataggtacttacatgtagataaattaataaaactacctaaatacacaattacacatgatttagctgaaggggcgatctaattccacatcttatacatagctttataaatatgcctcaagatttagggcaccccttttcgtccttgtttatcacatggagaactcagaaggaaattgtttctgctataaaactatatgtaaatagccctttttttatgaattaattagatgccaccaatttttatgaaaggatcaggagaactgtagttctttttttttacctgcatggaggtgcaggcagctgcctctctgagttattataatggtttggctgctgaaaatcgggtaactggagctgcatgatccataggttgaaaggctgactatgcattttttgtaaagattagaatgactgcttttatgtaatgcattgtgtttcagttgaatgtacacaggcaatatactggtgtcattatggatatatgagttacatcaaaatatatgccatttttgggcagtttagccttttataactatgagctgtgatccttttcttttgcatatgggaaaaaatttaaatgtaaaattcatattctgtattcatattttatttttgaaaaacatgcattaacaaagtggatggggtacaattgctactgatggtgtatatgtgtacactatagaaaaggaaagactgctgtgtttttgaaagattgtacaaatgctgataaagagtgcctagtcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAIMGVQMVVTLLVASIMQRVSPHYSFGRWLLCNGSLFRFKHPTEEELRTLAGKQKPKAKRERRTNGVTDEKPLTVPKDIDLRLDTQPITTIDALGLASVCHNLENFLAQRGWQWSMPFVKLAFKIALVALCAFLGGCLTFPGLRLAQTHLDALKMAADRPMLQLLLHMSFLPPVIVVVLWIRPITRDFLLNAPMGKESVELMSNSAYNTFRLWIIVVLCLLRFCLTRFHLQAYLCLADRWVEQMKREAGRISMLEIQRKISRIFCYLTVVALQYLAPIVLTFHCVLMLKSLGDYSWGLYPEPTGFTPVVDSSPVQSHSPTSEEEEDTEDVQAAVEQIMGAMSSLRGLFTPLFFRGLFSFLTWWVSVCQIVTSLFGLYFHQYLGAS
Donor tissue: tailbud