ORFeome > MGC69456 – XORFeome 2.0

MGC69456 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC69456 protein, mRNA (cDNA clone MGC:69456 IMAGE:5335976), complete cds
Gene Symbol: MGC69456
Gene ID: 448059
ORF gb_acc: MG133362
ORF ID: 10867

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC074582

Library Location

Plate ID: GDExt11008
Well Location: F10

EST Sequences

Clone: MGC:69456 IMAGE:5335976
Trimmed Sequence: ATGGATACATACAAAAAAGAGATGGAGATCCTAAGCAATAGCATTGCAGCGTATGCTCACATTCGAGCTAATCCTGCATCGTTTGGTCTTTACTTTGTCCTTGGTGTCTGTTTTGGGCTGATTATAACACTTTGTCTGCTTGTTATCCGAATCTCCTGTAAGCCTCGGACCCCAAGCATTCCTCCCAAACCAAAAAAGTCACCTCCTAAAGATTGTGTCAAGGAGCCTCTGTCTGTGGCAGGAGATGAGGAGGATCCAGAAAGTGATGACAATGAGGAAACCTTCATCCTAAATCCTGTTACAGAAACACCACTGAACAACCAGTCTTCAGCAGATGGAACGCTGACAGTCAATGTTTTCACATCGGCAGAAGAGTTAGAGAGGGCCCAAAGGTTGGAAGAAAGGGAAAGGATAATCCGTGAGATCTGGCGTAATGGGCAGCCTGATATACTGGGAACAGGAACTGGCACTATAGGCCGTGTACATTACTATTAA
Full Trace Sequence: tggaaagtcaatggctgctgcatcgcaatgacactgccacacaaacagagcccggcatgaagagacacagtatctgtacagagggaatctaaaagggatttccagcgttacagtcgcagccataccaggataccctgcagttaagtttcacagggttcctattctgaggcaatggatacatacaaaaaagagatggagatcctaagcaatagcattgcagcgtatgctcacattcgagctaatcctgcatcgtttggtctttactttgtccttggtgtctgttttgggctgattataacactttgtctgcttgttatccgaatctcctgtaagcctcggaccccaagcattcctcccaaaccaaaaaagtcacctcctaaagattgtgtcaaggagcctctgtctgtggcaggagatgaggaggatccagaaagtgatgacaatgaggaaaccttcatcctaaatcctgttacagaaacaccactgaacaaccagtcttcagcagatggaacgctgacagtcaatgttttcacatcggcagaagagttagagagggcccaaaggttggaagaaagggaaaggataatccgtgagatctggcgtaatgggcagcctgatatactgggaacaggaactggcactataggccgtgtacattactattaatggaaaaaggagaaagttatctacattatattaattgtggtgccagatagcccaatgccgtggtttttaaaatggcataagctacactacatacataattacttaccatttctggtaatctgtgtgccagtagttggtattttactaatagtagctgaaaaagcacaaatggcgcagctgtcttacatggatggtgctttagtaaatatagaggaattagacaacatagtctattgactcaaaaattgtcaattctggcttcatgggctgtgtgagagacaaccacataaactgatgctcttcgcagaggatttacattgatcaagtgtctttcttgagaggacagaagttcagactggtacttaatcagtttggccaagtattcataagcagggaaacatctgggatagaacttgtgtatcactgtttgatcagactgaatttgttacttggctggaattggtactcagctcaggacctcgtgatgcatctcattggtattcatttgtattaatggccaactgtgcttacagtctcgctggtgtctccattattagatttgctgactggtgattgtagaagcttcatgagcctgtagtcatcctgtctgcgctcagcaggaagtttatcaaacactgatggtgacctttcagctggctcttagctggaggaggaggatgctttgagttatgcttgatgtctttaatgaccggtaacaccaaaaaattaaaaaatcttaattgttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MDTYKKEMEILSNSIAAYAHIRANPASFGLYFVLGVCFGLIITLCLLVIRISCKPRTPSIPPKPKKSPPKDCVKEPLSVAGDEEDPESDDNEETFILNPVTETPLNNQSSADGTLTVNVFTSAEELERAQRLEERERIIREIWRNGQPDILGTGTGTIGRVHYY
Donor tissue: tailbud