ORFeome > MGC69527 – XORFeome 2.0

MGC69527 – XORFeome 2.0

General Information

Species: Xenopus tropicalis inhibitor of DNA binding 4, dominant negative helix-loop-helix protein, mRNA (cDNA clone MGC:69527 IMAGE:5336559), complete cds
Gene Symbol: MGC69527
Gene ID: 448114
ORF gb_acc: MG133339
ORF ID: 10840

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC074645

Library Location

Plate ID: GDExt11008
Well Location: G07

EST Sequences

Clone: MGC:69527 IMAGE:5336559
Trimmed Sequence: ATGAAAGCTGTCAGTCCAGTGCGCCCGCAGAGTCGGAAAGCCCAAGTGCCGGCGGTGTGCGGGGAGCTGGCGTTGCATTGCCTGTCTGAGCACAGCCTGGGGGTGGCTCGCTACAAGATGGAAGAAGAGGAGACCCTGTGCCTGCAGTATGACATGAATGACTGTTACAGCCGGCTCAAGAGGCTGGTGCCCACCATTCCGCCGAACAAGAAAGTCAGCAAAGTGGAAATCCTGCAGCATGTTATTGACTATATCTTGGATCTGCAGTTGGCGTTAGACACGCACCCAGTGCTGCTCAGGCAACAGCCACCTACCAGGACCCCTCTTACGGACCTCAATACTGACCCGGCTGCCTTAGTGGTGAACAAACAAGGAGACAGTATTTTGTGCCGTTAA
Full Trace Sequence: ctgctagggagctgcagaactgggaggctgaatgtccagctgactgataggatcctgctgtccttgccactactatctgcagagctgccttcctgtcattccgcctgagtgccctgttatcccgagcaaacagctgctttgtagcagccagaccgagcctaataaggaattgcatttgccaagcagttggtgcccccttatctagaaagaagcggcacctgtatcttcccccagtgtctctgcgttggattgacactcgcatggtctatttctgttgctgttcagctgcagggtagatagtcgctgctgctgctgctctgtgtaggacacggacaggcgcgccacacacaaggctccagtagctgctgccatgaaagctgtcagtccagtgcgcccgcagagtcggaaagcccaagtgccggcggtgtgcggggagctggcgttgcattgcctgtctgagcacagcctgggggtggctcgctacaagatggaagaagaggagaccctgtgcctgcagtatgacatgaatgactgttacagccggctcaagaggctggtgcccaccattccgccgaacaagaaagtcagcaaagtggaaatcctgcagcatgttattgactatatcttggatctgcagttggcgttagacacgcacccagtgctgctcaggcaacagccacctaccaggacccctcttacggacctcaatactgacccggctgccttagtggtgaacaaacaaggagacagtattttgtgccgttaaaccatttttgaggtgtgcagcaggcgaatccagagccagaagaggagagagacaaattagagaaataagggaggggaaggaaaaagcagacaaaagagggggaaaagcaacgtacacatcactttcttacaccaccaagaatatattcctgtcatttgctcataccactgaacactttccctcgtgtttttcatccaacgtgatttaatttcttacctttttttgtgaagaattatggaagagtcagatatacaatgtatttggacagggggtagtttagaggactaaagagagaatatgctataatatgaagaactgaatactgaagctttactaatataccagagctttgtagatacatttttttacatctattgtttaaaatagatgattttattggttcagggaattttttttccctgcaggaatgttacatattgtatagagaaatccgagtgacatttcatactatgtatatatagagatgttctataagtgtaagtgataaagtatatgctttaatagactactgtaattatgaagtatttttaattaaatattttgtgtaaatataaatttgtgtttttttttaacctccgggggggtctgttcctatttggataagaaaataaacagcgatttatcaagaatttgttaaaaccaatcatttgctgccgaagcccttccctccagcagtaaagagccttttttttattttattttttaactttctcattaaccccatctttgcatgattgcatggtgcgttttaattggacttttaattgtccatcgtggcacattaacacaaaaacacatttgttctctgaagtgcagcttcgtataaaaactatatgtaattgttttaaacctaaaggttacatgatttgccgtgcagttgtgatgtgtacaagtatgggatctattatccaaaaaccagttatctggaaaggtcactaatagggcagataattcattgctttcttacttcacttgatacttactaagccagcataaaatgcatgctgatggcacgacaacccaaataagatttttatttttttagtagctctcaggcaacatgatccatataacataaaggtcacttatcttaaaaactgcaggtcctaagcattgtatccaatcccaatatatgtactttactctttccggatataactgtattgctctcattgtatttaaaatataaaaaagaaatgtactctctctcttatatgtattattgtagtaccttttactaatggctttatcaccaccaaatatccccttactctaaattaaattagtttgcattttctgaaactgaataaatagctctgttcattgtttagcgaatctagattaattcagtgcataagcctgatagactgtcatcatttttacagtcaaactcttgggctgtaacagtgttcccagtttttatacagaaatggcatctataaggaattcttgggacctttgttctttttggatatggggttgttccataatatggagcagtatactaatcaacagagttgttgtgccaccttcatgaatattaatttagttttcatcacgtacaaggcactgccttatatgagaagaagctcataatttcaaattgtttaaataagaagctgtagaaaatgactttacaatattttctggttaataggtttccagataacacatcccacaactgtttcaaaattctaacatatgatcacggtttgtattttaaaaggtctggcattaaaatatatcataaataaatcatttactgccacccagttctattgctgcaaaacctgtttcttggtccgatcctctgataacccttgtgtctctctctgttagccatttacaaacgtgtataggaatctaatttttgtttagacatttgaatgctatttcccccttatttccaggctgtttaagcaggcagtgtacttacaatgttatccgtatgattaaaaataaaaagccacagtcccatgcgttgatggcaaaattaagatgaaatgttgtagtggggagttctaaacagcatccctcaattattaactgttctgcaatcatgtaagaatcagtgactactgttatctcatgcactttgacatatgagtattaaaattaaatttttacctgcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MKAVSPVRPQSRKAQVPAVCGELALHCLSEHSLGVARYKMEEEETLCLQYDMNDCYSRLKRLVPTIPPNKKVSKVEILQHVIDYILDLQLALDTHPVLLRQQPPTRTPLTDLNTDPAALVVNKQGDSILCR
Donor tissue: tailbud