ORFeome > MGC75598 – XORFeome 2.0

MGC75598 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC75598, mRNA (cDNA clone MGC:75598 IMAGE:5379219), complete cds
Gene Symbol: MGC75598
Gene ID: 394981
ORF gb_acc: MG132783
ORF ID: 10103

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064157

Library Location

Plate ID: GDExt11002
Well Location: A06

EST Sequences

Clone: MGC:75598 IMAGE:5379219
Trimmed Sequence: ATGGCAAACAAAGGGCCTGCCTACGGACTGAGCCGCGAGGTGCAGCAGAAGATCGACCAGAAGTACGACAATGATCTGGAGACCATCTTGGTGCAGTGGATCAAAGCTCAGTGTGGGACTCATGCTGGGTCGTTCGACGGGCAAGGGAAGTCAGCCGTACAGGTCTGGCTAAAGGACGGCACTGTGCTTTCCCATCTCATTAACTCCTTGGCCCCTGGGTCTATTGCAAAAGTGCAGACATCTGCCATGGCGTTCAAGCAGATGGAGCAGATCTCACAGTTCCTGAAGGCCTGCGAACGATACGGAATTCCGGCCTCCGATCTGTTCCAAACTGTTGACTTGTGGGAAGGCAAGGACATGGCCAGCGTACAGAGGACACTCATGAATTTGGGGGGCATTGCTGTGACAAAGGGTGATGGCTACTTCCGTGGTGACCCCAACTGGTTCCCAAAGAAATCCCAGGAGAACAAGAGGGAGTTCTCCCAGGACAAGTTAAAAGAGGGCCAGAACATCATCGGCCTTCAAATGGGCACCAACAAGGGAGCATCGCAGTCCGGCATGACTGGCTATGGCATGCCAAGGCAAATCCTCTGA
Full Trace Sequence: gggaagtgtgtgctgtaaggaactctgctcataaaaaacatggcaaacaaagggcctgcctacggactgagccgcgaggtgcagcagaagatcgaccagaagtacgacaatgatctggagaccatcttggtgcagtggatcaaagctcagtgtgggactcatgctgggtcgttcgacgggcaagggaagtcagccgtacaggtctggctaaaggacggcactgtgctttcccatctcattaactccttggcccctgggtctattgcaaaagtgcagacatctgccatggcgttcaagcagatggagcagatctcacagttcctgaaggcctgcgaacgatacggaattccggcctccgatctgttccaaactgttgacttgtgggaaggcaaggacatggccagcgtacagaggacactcatgaatttggggggcattgctgtgacaaagggtgatggctacttccgtggtgaccccaactggttcccaaagaaatcccaggagaacaagagggagttctcccaggacaagttaaaagagggccagaacatcatcggccttcaaatgggcaccaacaagggagcatcgcagtccggcatgactggctatggcatgccaaggcaaatcctctgaccacacagacgaccgaaggaaccatccaagaaccaaaatggatacatactcatctcccataacttgcccattccttctctccacccttcaccttctgttagttgatagggcacattcccgaccatgtctgaggcaccactgtgctttcagagagcaatctttcttactgccattaagctccgaaccactttagcatataaacattacagtgtttgcaggaagcagactagttagccagcatcaagtgggtcttgaccgattgtatgcttatatctcaagcttggaattgtgcttagatagccgtagctatatctccacacccatttcaaggaccctagaaattatttaaatatggaacgaagctgttctggtaaataaggcagctgtttggttctcagcagtgaacagaaagatgactccatgtcttaattttattgccttaatatggtgggcaccacgatgatcttccttcttctctcttgccttaacattccacttgtagtgcctaattatttttttttatatgtatacctgtttgaccaaattttaaaagtttttgtacctcccccccaaaaaccagactgatttttttttgttcggttttgactaaatgtttggtaagcattttcacaaaggtcccgtagcattgttccatatattccgccattgaggcgttctacggcacactgagtttctccctgccgtggatttctttccattgatacccataatatttgcatgggtcacctcaagcctgctcgttaaatacctagccagggagacgttgagcgacaggtagcgggtatttgctttgtagctaatactgaagcccatcagaaagtcccgttggcctgaacaaggcatcagaagggtcttttggggcaacacaagtcaataatgccatttctcaagtaaatggaaccttcaaccaaccagttgttgttgagctattaatctcagaatactgggaggtctgaagatcttcacatccatgctttataatctatccacttcagtttgggcgcttcggcattgtgctggggtccaccttctctccttccctgcttgccaccatattcctgcctgtgtaaaccagtggttctaccttctgttcccctcaagatatgttgctgataaatattcaattaaagaccaatctatgtttataaaaaaaaaaaaaaaaaaaaaaa
Translation: MANKGPAYGLSREVQQKIDQKYDNDLETILVQWIKAQCGTHAGSFDGQGKSAVQVWLKDGTVLSHLINSLAPGSIAKVQTSAMAFKQMEQISQFLKACERYGIPASDLFQTVDLWEGKDMASVQRTLMNLGGIAVTKGDGYFRGDPNWFPKKSQENKREFSQDKLKEGQNIIGLQMGTNKGASQSGMTGYGMPRQIL
Donor tissue: tailbud