ORFeome > MGC75653 – XORFeome 2.0

MGC75653 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC75653, mRNA (cDNA clone MGC:75653 IMAGE:5379646), complete cds
Gene Symbol: MGC75653
Gene ID: 394951
ORF gb_acc: MG132865
ORF ID: 10222

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064174

Library Location

Plate ID: GDExt11003
Well Location: D03

EST Sequences

Clone: MGC:75653 IMAGE:5379646
Trimmed Sequence: ATGGGGACACAGGGCCAGAGATGGGTGCCGTATATTCTATGTGCAGTGCTTGCGACAGTCTCCGCCATTACCGTAGACACGCCGAACAAAATAGTTGAAGCCGCTAGAGGGAAGAACGCCACGTTGCCCTGCACCTACCAAAGCGTGGCAGATAAAACTGGCAGCATTATTGGCTGGAAAAAATTTGATACCCAGGATGAGGTTATCTCCTACTATTCAGGTGGTGACCGCACATATGGAGATGCTTACACTGGGAGGGTGTCGTTTATCGGTGACCCGGGGGTTAATAACGTAGGGATCACCATGACTCAGCTGACTATGCAGGACAATGGCACGTACCAGTGTGAAGTTATCATCCCCAAAGATCGCAAAGGAACCCCTACTGCCAAAATGGACCTTGTTGTATTAGTGGCCCCGACCAAACCCATCTGTGGCATCGAAGGGACCTCCGAGTACGGACAAGACATCAAGCTGAAATGCAACTCAGTAGAAGGATCCCCGGTCCCCGACTATCAGTGGACAAGTTACAACCCCCAGAATGCACCACGGCAGCTACCACTGACATCTGTGAGGGAAGGAAGTGATCTGAAGCTGAAGAACATCTCGGCCGACACCTCTGGTTATTATATCTGTGTCTCCAAGAACAAAGTGGGGGAAGAGTCCTGTAATATCACAGTAGTAGTGATGCCACCTTCGATGAACATCGGGCTCTACGCCGGGATCATTGGAGGAGGTGTAGCCGCAGTCATAGTGATCGGTATCCTCGTCTACTGCTGCTGCTGCCGCGACTCTGGGGATAAAGAGGATTACGAGATGGGATACAGAGATGATGAGGAAGAAGTCGATCCACGGCAACAGAACAAACAGCAGATGCAGAGAAATCAGAGGGAGGAATATGACGATGATGATGGCTACCAGGAGAGCAAACGAGGCACGGGCCCCCCGGTGCCACCGGCTAACAGCAAACCTCGCATGCTTAACGATTCTGCTGATGCTTAA
Full Trace Sequence: gggaggaagggctcagtttggtttgtgccaccattgcctgccctgggaactcacagacctgaagcagccgggatggggacacagggccagagatgggtgccgtatattctatgtgcagtgcttgcgacagtctccgccattaccgtagacacgccgaacaaaatagttgaagccgctagagggaagaacgccacgttgccctgcacctaccaaagcgtggcagataaaactggcagcattattggctggaaaaaatttgatacccaggatgaggttatctcctactattcaggtggtgaccgcacatatggagatgcttacactgggagggtgtcgtttatcggtgacccgggggttaataacgtagggatcaccatgactcagctgactatgcaggacaatggcacgtaccagtgtgaagttatcatccccaaagatcgcaaaggaacccctactgccaaaatggaccttgttgtattagtggccccgaccaaacccatctgtggcatcgaagggacctccgagtacggacaagacatcaagctgaaatgcaactcagtagaaggatccccggtccccgactatcagtggacaagttacaacccccagaatgcaccacggcagctaccactgacatctgtgagggaaggaagtgatctgaagctgaagaacatctcggccgacacctctggttattatatctgtgtctccaagaacaaagtgggggaagagtcctgtaatatcacagtagtagtgatgccaccttcgatgaacatcgggctctacgccgggatcattggaggaggtgtagccgcagtcatagtgatcggtatcctcgtctactgctgctgctgccgcgactctggggataaagaggattacgagatgggatacagagatgatgaggaagaagtcgatccacggcaacagaacaaacagcagatgcagagaaatcagagggaggaatatgacgatgatgatggctaccaggagagcaaacgaggcacgggccccccggtgccaccggctaacagcaaacctcgcatgcttaacgattctgctgatgcttaatgcacaaatgtaacaaaactgactggagaacattattttttttatatatatcgaaaaggacttttttagcagttaagatacatttatacccatcaactggaacccccctttttttttttttttacctttttgtattgtttgtcagaaacaaaagggttaatagagcagcggggacacagttaattaattgagcacggatgtcggattaagatttgtatttatgttggtttttaattaatatctgcgctgataggggccttacactgacatcgctggtcagtttagatggagatgcccatagggctggctgagccaatggctactacccgctagagaatcatagcctgacccgaacccctcgcactgtccggcctagaaaccaccctgtcagtaagtgggtcagtctgtcatttcttggcatttttagtttcccaatatttgttaaatgttttttgtataaagtctgtatgtgtacaagggaacttgtttggtttaaaggtattttttttggttaggaagaaatgaaaagtaaagtttatatccaaatataaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MGTQGQRWVPYILCAVLATVSAITVDTPNKIVEAARGKNATLPCTYQSVADKTGSIIGWKKFDTQDEVISYYSGGDRTYGDAYTGRVSFIGDPGVNNVGITMTQLTMQDNGTYQCEVIIPKDRKGTPTAKMDLVVLVAPTKPICGIEGTSEYGQDIKLKCNSVEGSPVPDYQWTSYNPQNAPRQLPLTSVREGSDLKLKNISADTSGYYICVSKNKVGEESCNITVVVMPPSMNIGLYAGIIGGGVAAVIVIGILVYCCCCRDSGDKEDYEMGYRDDEEEVDPRQQNKQQMQRNQREEYDDDDGYQESKRGTGPPVPPANSKPRMLNDSADA
Donor tissue: tailbud