ORFeome > MGC75673 – XORFeome 2.0

MGC75673 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC75673, mRNA (cDNA clone MGC:75673 IMAGE:5380037), complete cds
Gene Symbol: MGC75673
Gene ID: 394915
ORF gb_acc: MG132818
ORF ID: 10165

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064185

Library Location

Plate ID: GDExt11002
Well Location: C07

EST Sequences

Clone: MGC:75673 IMAGE:5380037
Trimmed Sequence: ATGTCCGTCTCCCACAGTTCGAGACTCAACAAGGGGGTGAGGGAACAGTACATGAAACTGCCCCAAGGAGGGAAGGTCCAGGTCACCTACGTCTGGATCGACGGCACCGGGGAGGGAGTGAGGTGCAAGACCCGGACTCTGGATCAGGAACCCAAAACCATAGATGAAATCCCAGAATGGAACTTCGATGGATCCAGTACGTACCAAGCAGAAGGTTCAAACAGTGACATGTATCTCGTCCCAGTCCAGATGTTCAGAGACCCCTTCTGCCTGGACCCCAATAAGCTGGTTATGTGCGAAGTCTTAAAATACAACCGCAAGTCTGCAGAGACCAACCTCCGACACACGTGTAAGAAGATCATGGAAATGGTGACTGACCATCGCCCATGGTTTGGAATGGAACAGGAATACACCCTGCTGGGCATTAACGGGCACCCGTATGGTTGGCCAGAGAACGGCTTCCCTGGGCCACAAGGTCCCTATTACTGCGGCGTGGGGGCGGATAAGGTGTACGGGCGGGACATCGTGGAGGCGCACTACAAGGCGTGTCTATACGCCGGCATCAAGATCTGTGGCACCAACGCGGAAGTCATGCCCTCCCAGTGGGAGTTCCAGGTGGGACCGTGCGAAGGCATCGACATGGGGGACCACCTATGGATGGCCAGGTTCATCCTCCACCGGGTGTGCGAGGACTTCGGGGTGGTGGCCACGCTGGACCCCAAGCCCATGACCGGAAACTGGAACGGCGCTGGTTGCCATACCAACTACAGTACAGAGAGCATGAGGGTCGAAGGGGGACTCAAACACATAGAAGATGCCATTGAGAAGCTCGGGAAGAGGCACAACTACCACATCTGCGTGTATGACCCCCGGGGCGGGAAGGACAACTCCCGGAGACTCACCGGGCAGCACGAGACGTCCAGTATCCACGAGTTCTCGGCCGGAGTCGCCAACCGGGGCGCCAGCATCCGGATCCCCCGCCAGGTGGGGCAGGAAGGCTACGGTTACTTCGAGGACCGCCGGCCGGCAGCAAACTGCGACCCCTACGCCGTTACCGAGGCGCTGGTCCGAACGACCATCTTGAACGAGACCGGCAGCGAGACCAAAGACTATTAG
Full Trace Sequence: caacaacttgctgagggaccagagggccagtgctgcttcccttgctaataagatcagccgccgccatgtccgtctcccacagttcgagactcaacaagggggtgagggaacagtacatgaaactgccccaaggagggaaggtccaggtcacctacgtctggatcgacggcaccggggagggagtgaggtgcaagacccggactctggatcaggaacccaaaaccatagatgaaatcccagaatggaacttcgatggatccagtacgtaccaagcagaaggttcaaacagtgacatgtatctcgtcccagtccagatgttcagagaccccttctgcctggaccccaataagctggttatgtgcgaagtcttaaaatacaaccgcaagtctgcagagaccaacctccgacacacgtgtaagaagatcatggaaatggtgactgaccatcgcccatggtttggaatggaacaggaatacaccctgctgggcattaacgggcacccgtatggttggccagagaacggcttccctgggccacaaggtccctattactgcggcgtgggggcggataaggtgtacgggcgggacatcgtggaggcgcactacaaggcgtgtctatacgccggcatcaagatctgtggcaccaacgcggaagtcatgccctcccagtgggagttccaggtgggaccgtgcgaaggcatcgacatgggggaccacctatggatggccaggttcatcctccaccgggtgtgcgaggacttcggggtggtggccacgctggaccccaagcccatgaccggaaactggaacggcgctggttgccataccaactacagtacagagagcatgagggtcgaagggggactcaaacacatagaagatgccattgagaagctcgggaagaggcacaactaccacatctgcgtgtatgacccccggggcgggaaggacaactcccggagactcaccgggcagcacgagacgtccagtatccacgagttctcggccggagtcgccaaccggggcgccagcatccggatcccccgccaggtggggcaggaaggctacggttacttcgaggaccgccggccggcagcaaactgcgacccctacgccgttaccgaggcgctggtccgaacgaccatcttgaacgagaccggcagcgagaccaaagactattagacctgagctgggagctggcttctcctggtcaatcactatggcatctcccgagacgccgccatgtttttttaacccgttagactcccgacactacttgaattcttctaaggtgtatagatggttctaccatattgtctgtaaggttgggggggggggctgctgattattttagatctataggataagaacaaagcgagtgaccctgctggaatctgattggctggtgctgactgattccttcagtttctccctttggggagggcgggattgttaattggctcctctggagctacgggctttatacaactgtctttatacccacgatatcgactgtactcaattgtattgtttttaatgatgaataaagacctttgaataaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSVSHSSRLNKGVREQYMKLPQGGKVQVTYVWIDGTGEGVRCKTRTLDQEPKTIDEIPEWNFDGSSTYQAEGSNSDMYLVPVQMFRDPFCLDPNKLVMCEVLKYNRKSAETNLRHTCKKIMEMVTDHRPWFGMEQEYTLLGINGHPYGWPENGFPGPQGPYYCGVGADKVYGRDIVEAHYKACLYAGIKICGTNAEVMPSQWEFQVGPCEGIDMGDHLWMARFILHRVCEDFGVVATLDPKPMTGNWNGAGCHTNYSTESMRVEGGLKHIEDAIEKLGKRHNYHICVYDPRGGKDNSRRLTGQHETSSIHEFSAGVANRGASIRIPRQVGQEGYGYFEDRRPAANCDPYAVTEALVRTTILNETGSETKDY
Donor tissue: tadpole