ORFeome > MGC75677 – XORFeome 2.0

MGC75677 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC75677, mRNA (cDNA clone MGC:75677 IMAGE:5380114), complete cds
Gene Symbol: MGC75677
Gene ID: 394498
ORF gb_acc: MG132850
ORF ID: 10202

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061605

Library Location

Plate ID: GDExt11002
Well Location: D08

EST Sequences

Clone: MGC:75677 IMAGE:5380114
Trimmed Sequence: ATGAGTGAAGAGGACAGGTTTGCCTTTATTGCTGAATGGTATGATCCAAATGCAGCAATACAAAGACGATACCAGCTGAACTATTACACTAAGGATGGATCTGTTGAAATGTATGACATTAAAAACCATCGAGTGTTTTTAAGACGAACAAAATATGATGAAATTTGTAAGGATGATTTATTTGTGGGCAACAAAATTAATGTTTTTTCACGGCACCTTCATTTAATTGACTACGCAGATCAATATACTTCTCGAAAGGTTGGAAGCAAGAAGGAAAAAACATTAGCTTTGATAAAACCAGATGCTGTAACAAAAATGGGTTCAATTATTGAAGCCATACTGGACTCAGGGTTTGTAATCTCAAAGGCTAAAATGGTTTTGCTCTTAAGAACTGAAGCAATGGACTTTTATAATGAACATCATTCAAAATCATTTTTTAGTGATCTTATTAGTTTTATGACAAGTGGGCCCATTGTAGCAATGGAGGTAGTTGGAGATGAAGCTGTCTCTTCATGGAGAAAATTATTAGGACCAACAAATTCCAGCATTGCAAGGAGTGAACTTCCTCAGAGCATAAGAGCAAGGTTTGGAACTGATGGCACCAAGAATGCAGCTCATGGTTCAGATTCCATTGCTTCAGCTGCTCGTGAATTGGAATTTTTCTTTCCATCAAGTGGAGGACGTGCTCCAAAAAATACTGCAAAGTTTACAGACTGTACTTGCTGTATTATTAAGCCCCATGCCATTTCTGAAGGCCTAACTGGAAAAATCCTTAATGCAATATTGGATGCAGGCTTTGAGATTTCAGCAATGCAAATGTTTACCATCGAGAGAGCCAACGCTGAGGAGTTCTGTGAAATATATAAAGGTGTGGTAGCAGAATTCAGTGATATGATTGTAGAATTGTGTTCTGGTCCATGCATTGCTTTAGAGATACGGGATGCCGAAGCTCCAAAACGTTTCAGAGATTTCTGTGGTCCTGCTGATCCTGAAATAGCTCGCCATTTGCGTCCTAAAACACTTCGTGCTCGCTTTGGAAAAAACAAAATTAAGAATGCTGTTCATTGTACTGACTTACCAGAAGATGCGCCATTAGAGGTGCAATATTTTTTCAAGATTCTGGATAGCTGA
Full Trace Sequence: gggagacaacggagtgggacgcttgagagagaagtcgagttactgacaacacagtaggggcctgcgctgttgatataaaatgagtgaagaggacaggtttgcctttattgctgaatggtatgatccaaatgcagcaatacaaagacgataccagctgaactattacactaaggatggatctgttgaaatgtatgacattaaaaaccatcgagtgtttttaagacgaacaaaatatgatgaaatttgtaaggatgatttatttgtgggcaacaaaattaatgttttttcacggcaccttcatttaattgactacgcagatcaatatacttctcgaaaggttggaagcaagaaggaaaaaacattagctttgataaaaccagatgctgtaacaaaaatgggttcaattattgaagccatactggactcagggtttgtaatctcaaaggctaaaatggttttgctcttaagaactgaagcaatggacttttataatgaacatcattcaaaatcattttttagtgatcttattagttttatgacaagtgggcccattgtagcaatggaggtagttggagatgaagctgtctcttcatggagaaaattattaggaccaacaaattccagcattgcaaggagtgaacttcctcagagcataagagcaaggtttggaactgatggcaccaagaatgcagctcatggttcagattccattgcttcagctgctcgtgaattggaatttttctttccatcaagtggaggacgtgctccaaaaaatactgcaaagtttacagactgtacttgctgtattattaagccccatgccatttctgaaggcctaactggaaaaatccttaatgcaatattggatgcaggctttgagatttcagcaatgcaaatgtttaccatcgagagagccaacgctgaggagttctgtgaaatatataaaggtgtggtagcagaattcagtgatatgattgtagaattgtgttctggtccatgcattgctttagagatacgggatgccgaagctccaaaacgtttcagagatttctgtggtcctgctgatcctgaaatagctcgccatttgcgtcctaaaacacttcgtgctcgctttggaaaaaacaaaattaagaatgctgttcattgtactgacttaccagaagatgcgccattagaggtgcaatattttttcaagattctggatagctgaattgaaaaacagaagaatccaaaacaccaaactttgtttattgttttattgtctcatgtttaacttgactgaagttccaacaagagcacaggactcctggcaattattacagatgtatgaacaatgtgtgcacagtagacatttaaatacatcctatgggatactgcattgccatgaacgttgttttaaaataaagatttatttttcaacaggaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSEEDRFAFIAEWYDPNAAIQRRYQLNYYTKDGSVEMYDIKNHRVFLRRTKYDEICKDDLFVGNKINVFSRHLHLIDYADQYTSRKVGSKKEKTLALIKPDAVTKMGSIIEAILDSGFVISKAKMVLLLRTEAMDFYNEHHSKSFFSDLISFMTSGPIVAMEVVGDEAVSSWRKLLGPTNSSIARSELPQSIRARFGTDGTKNAAHGSDSIASAARELEFFFPSSGGRAPKNTAKFTDCTCCIIKPHAISEGLTGKILNAILDAGFEISAMQMFTIERANAEEFCEIYKGVVAEFSDMIVELCSGPCIALEIRDAEAPKRFRDFCGPADPEIARHLRPKTLRARFGKNKIKNAVHCTDLPEDAPLEVQYFFKILDS
Donor tissue: tadpole