ORFeome > MGC75683 – XORFeome 2.0

MGC75683 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC75683, mRNA (cDNA clone MGC:75683 IMAGE:5380187), complete cds
Gene Symbol: MGC75683
Gene ID: 394905
ORF gb_acc: MG132851
ORF ID: 10204

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064187

Library Location

Plate ID: GDExt11002
Well Location: A10

EST Sequences

Clone: MGC:75683 IMAGE:5380187
Trimmed Sequence: ATGTGCGGGAATAACATGTCTGTACCGCTACTCACCGATGCCGTGACCGTGCCTGCGGGGGAACGGGAGACCGGGGCGGTGATATTCCTTCATGGACTTGGTGACACAGGACATGGCTGGGCCGAGGCACTGTCAGCCATCAGACTGCCACATGTGAAGTATATTTGCCCACATGCGCCCCGTATTCCAGTCACTCTGAACATGAAGATGGTGATGCCTGCATGGTTTGATCTGATGGGTCTGAGTCCTGATGCTCCTGAAGATGAGGCGGGAATCAAGAAGGCAGCAGAGAGCATTAAGACTATCATTGAGCATGAAGTAAAGAATGGAATCCCGGCCAATAGGATTGTCTTGGGTGGTTTCTCTCAGGGAGGGGCTCTTTCTCTGTACACAGCCCTCAGCTGCCAACACAAACTGGCTGGAGTAATTGGACTAAGCTGTTGGTTGCCTCTTCATAAGACATTCCCTCAGGCTGCAAGTGGTGTAAATAAGGAAATATCTGTTCTGCAATGTCATGGAGAAGCTGACCCTATGATTCCTGTTCGCTTTGGAAACCTCACCTCAGAGAAGCTGAAATCGGTGTTGAACCCTTCTAAAGTCCAGTTCAAATCATACCCTGGAGTCATGCATAGCACCAATCAGGAGGAAATGATGGCAGTGAAAGATTTCTTGGAGAAAGTGCTCCCACGAGTGTAA
Full Trace Sequence: gtcacgtgatatgcgccggggttagaatcgttgagctgctgcagctcattgtttttactgcccgggaggtcaggggtcacgggggcggtgtgtgtcatcactccggtgtatgtgcgggaataacatgtctgtaccgctactcaccgatgccgtgaccgtgcctgcgggggaacgggagaccggggcggtgatattccttcatggacttggtgacacaggacatggctgggccgaggcactgtcagccatcagactgccacatgtgaagtatatttgcccacatgcgccccgtattccagtcactctgaacatgaagatggtgatgcctgcatggtttgatctgatgggtctgagtcctgatgctcctgaagatgaggcgggaatcaagaaggcagcagagagcattaagactatcattgagcatgaagtaaagaatggaatcccggccaataggattgtcttgggtggtttctctcagggaggggctctttctctgtacacagccctcagctgccaacacaaactggctggagtaattggactaagctgttggttgcctcttcataagacattccctcaggctgcaagtggtgtaaataaggaaatatctgttctgcaatgtcatggagaagctgaccctatgattcctgttcgctttggaaacctcacctcagagaagctgaaatcggtgttgaacccttctaaagtccagttcaaatcataccctggagtcatgcatagcaccaatcaggaggaaatgatggcagtgaaagatttcttggagaaagtgctcccacgagtgtaacactttggtgactggattcaggaaaaatgttacttagcatcgcctcagtgtttctttctcacctaaaagattcctcatccttttatccacacccacactggtttgtgacataagtattttttttctgccagctgtgactggaactgtttaaggtactgtgtgaaggattacactcctgcaccctacaatgggttttggtgcaatgcaggacttcacaccactgctgcttcacacatcctcctagtattgcatttcatgtcattctgatgtaacgggtcttctactggtaacatcaggaagctatcatatacctctgaggagcaaatgagtattgtgaaagatacagtatgtgaatgtaccttaaaccctctatcctccttggagcagagctcaggcctttagcaacagtttctgtaccttggtgtaggtactcttccacagccaactgttgtccctgctgcacccaaacattatgctgttggaacagtcatgttctgagcttgatttaaataatagaccctaaatagttatttctgaagttcctacagctgtgcagatgtatcggttatctttgtgtggtgtgggctcagatggaccaattctgatgatttgtttgatcgataaatgtgttatgtgaataaataggaatgctggaattttgaataggtaaagggtccaaatgttttacctgcttgtaagatagataaattgagaacaaactgtacgtacgtaaggcagcattagagattattgcaattggtcacaatagccatctgtaaccacaaaagtatttgtgttagcagtagttgggctggtactggcctgcatattcatttaagtcttaggataaattgttttgtcctcattctcctgtgatcaaactggaatgcctttaggtattactgagtcttccagtgtccctaactctctccttaaagattattgccttgtcagtaaggggtaagcaggcctaaatcattctcacttgtgtctaaacataggtcacgtttccagtagggtgacagtgttacctatacctgaagtatagtgttcagtaaaaaaggtatctaactgcctaggaatgggttaaaggttttcttgggaatgctgttttaagcaaaaagctttccttgtgtccatgtctcatctggttctaaacagggagagataatgctgttggatgctgagctgtttaataaacacactagtaccaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MCGNNMSVPLLTDAVTVPAGERETGAVIFLHGLGDTGHGWAEALSAIRLPHVKYICPHAPRIPVTLNMKMVMPAWFDLMGLSPDAPEDEAGIKKAAESIKTIIEHEVKNGIPANRIVLGGFSQGGALSLYTALSCQHKLAGVIGLSCWLPLHKTFPQAASGVNKEISVLQCHGEADPMIPVRFGNLTSEKLKSVLNPSKVQFKSYPGVMHSTNQEEMMAVKDFLEKVLPRV
Donor tissue: tadpole