ORFeome > MGC75715 – XORFeome 2.0

MGC75715 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC75715, mRNA (cDNA clone MGC:75715 IMAGE:5380778), complete cds
Gene Symbol: MGC75715
Gene ID: 394470
ORF gb_acc: MG132962
ORF ID: 10338

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC059741

Library Location

Plate ID: GDExt11003
Well Location: A11

EST Sequences

Clone: MGC:75715 IMAGE:5380778
Trimmed Sequence: ATGGCTTTACCCAGGGTCTTTTTCGACATCGCCGTTGATGGCTGCCCGATGGGCCGTATTATCATGGAGCTCAGGAGTGATGTGGTTCCAAAGACTGCAGAGAACTTCCGTGCCCTTTGCACAAACGAGAAGGGGTTTGGCTACAAGAACTCTGGCTTCCACAGAATTATCCCTGAATTCATGTGCCAGGGAGGTGACTTCACCAACCACAATGGAACTGGTGGGAAATCTATCTACGGAAACAAGTTTGCTGATGAGAACTTCCAGCTGAGGCACACTGGCCCTGGAATCCTCTCTATGGCCAATGCTGGAGCAAATACAAACGGCTCCCAGTTCTTCATCTGCACTGCTAAGACCTCCTGGCTTGATGGAAAGCATGTCGTGTTCGGGACCGTTATTGATGGCATGGATGTCGTGAGAAATATGGAGAAACTAGGTTCTCAGTCTGGAAAACCCGCCAAAAAAATAGTTATTGCTAACTGTGGTCAGCTTTAA
Full Trace Sequence: ctcttgggctgtttagagttcagggggttaggaagctgcacgttgcgctcacggcaaggcactgtttattttcattctgcactatggctttacccagggtctttttcgacatcgccgttgatggctgcccgatgggccgtattatcatggagctcaggagtgatgtggttccaaagactgcagagaacttccgtgccctttgcacaaacgagaaggggtttggctacaagaactctggcttccacagaattatccctgaattcatgtgccagggaggtgacttcaccaaccacaatggaactggtgggaaatctatctacggaaacaagtttgctgatgagaacttccagctgaggcacactggccctggaatcctctctatggccaatgctggagcaaatacaaacggctcccagttcttcatctgcactgctaagacctcctggcttgatggaaagcatgtcgtgttcgggaccgttattgatggcatggatgtcgtgagaaatatggagaaactaggttctcagtctggaaaacccgccaaaaaaatagttattgctaactgtggtcagctttaaacaatgcatcctttagttgttagttcttgtttttttgttttttccttctggtcttaaaacaagcattcctctgcaacattaactggtagcttcagaaaaccccattcagtacttaaaatcttagtgctctttaaactactgcattttctgtggtgcttatccagttcctatgccatccaaattttccacaaattccaaaattgtgtcgatgagattaaaatgatgatcacaatatacagtgtctgtctctaaaccagtaaaggggatgttgactttaaaaaaaaaaaaaaaaaaa
Translation: MALPRVFFDIAVDGCPMGRIIMELRSDVVPKTAENFRALCTNEKGFGYKNSGFHRIIPEFMCQGGDFTNHNGTGGKSIYGNKFADENFQLRHTGPGILSMANAGANTNGSQFFICTAKTSWLDGKHVVFGTVIDGMDVVRNMEKLGSQSGKPAKKIVIANCGQL
Donor tissue: tadpole