ORFeome > MGC75737 – XORFeome 2.0

MGC75737 – XORFeome 2.0

General Information

Species: Xenopus tropicalis RAB3A interacting protein isoform alpha 1, mRNA (cDNA clone MGC:75737 IMAGE:5381291), complete cds
Gene Symbol: MGC75737
Gene ID: 394735
ORF gb_acc: MG132935
ORF ID: 10304

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061285

Library Location

Plate ID: GDExt11003
Well Location: E12

EST Sequences

Clone: MGC:75737 IMAGE:5381291
Trimmed Sequence: ATGGCCAGCGACCCTCTGGAAGGCTTTCATGAAGTGAATCTTGCTTCACCTACAACTCCAGATCTGGGCGTAAGTGATGTCAAAGCTCATGAACCAACTACCTCTCCGAATCCTATCTATCGGCCCCATTTAACTGTTGGCTCCAACCCTATTCAGCCCAATACTTTAAATGCTTCTGACCTTCCAACTCAGCCAGTGTACTCTTCTCCAAGGCATCTAAACTGTGGAAACACTACAGGCATAAGTCCCAATGTAACAGACTCTATATCCTACTCTACCTCTGGATGCCCAGCATGTTCCCTCAAACACAGCAGAAAAAAAGACAACCGTGCAGAGAGGGAGTTTTTACAAGGGGCCACATTGACAGATGTAGTGGATGGCTCAGATGATGTGCTTGGTTGCAGCACAGACAGCTTGTCAAGATTACGGAGTCCATCTGTCCAGGAAGTTAGAGACAGAGGTTATGAACGGTTACGAGAAGAGCTGGCTAAAGCTAAACGGGACCTAAAACTAAAAGATGAAGAATGTGAAAGACTCTCTAAAGTGCGGGACCAGTTGGGGCAGGAACTGGAGGAGCTGACAGCAAGTCTTTTTGAAGAAGCACATAAAATGGTCCGGGAGGCAAACCTGAAACAGGCTGCTGCAGAAAAACAGCTTAAGGAAGCACAGGGAAAGATTGATGTACTGCAGGCAGAGGTAGCAGCTTTGAAAACACTAGTTCTCTCAACCTCACCAACTTCTCCCACAAAAGAACTACAGCCAGCTGGAAAGGCACCCTTTAGGAAGGGCCATGTCAGGAACAAAAGCACAAGCAGTGCTATGGGTGGAGGAACACTAGACCTCAGTGTACTGCCACCAATTGTCATGGAACTGAAAGAGCCTGATTTATCCCTTTACTATGAATTCAGAACTTGGAAAGAAGAGCCTTCCATGGATAGGGCATGCCCATTTTTGCACAGAATATATCAGGAGGATATCTGCCCTTGTTTAACATTCCCTAAAAGTGAGCTAGCTGCAGCTGTTCTTGAAGCTGTAGAAAACAACACCTTAAGCATTGAGCCTGCTGGTCAGCAACCTGTGCGGTTTGTTAAAGCATCAGCTGTTGAATGTGGAGGATCAAAAAAATGTGCGTTAAGTGGTCAGACAAAGTCTTGTAAGCACAGAATTAAACTGGGAGACTCCAGCAATTACTATTATATTTCTCCTTGCTGTAGATATAGGATTGCATCTGTGTGCAATTTCTTTACATATATTCGGTACATCCATCAAGGACTTTTAAAACAGCAGGATGTTTTTTTTTCTTCCTCTTTTACAGTTGATCAGATGTTTTGGGAGGTCATGCAACTTAGGAAAGAAATGTCTCAAGCAAAACTTGGATATTTCAAAGAGGAGCTTTAG
Full Trace Sequence: cagccataaggctttgacaggtctctggatgatgtttttactatggccagcgaccctctggaaggctttcatgaagtgaatcttgcttcacctacaactccagatctgggcgtaagtgatgtcaaagctcatgaaccaactacctctccgaatcctatctatcggccccatttaactgttggctccaaccctattcagcccaatactttaaatgcttctgaccttccaactcagccagtgtactcttctccaaggcatctaaactgtggaaacactacaggcataagtcccaatgtaacagactctatatcctactctacctctggatgcccagcatgttccctcaaacacagcagaaaaaaagacaaccgtgcagagagggagtttttacaaggggccacattgacagatgtagtggatggctcagatgatgtgcttggttgcagcacagacagcttgtcaagattacggagtccatctgtccaggaagttagagacagaggttatgaacggttacgagaagagctggctaaagctaaacgggacctaaaactaaaagatgaagaatgtgaaagactctctaaagtgcgggaccagttggggcaggaactggaggagctgacagcaagtctttttgaagaagcacataaaatggtccgggaggcaaacctgaaacaggctgctgcagaaaaacagcttaaggaagcacagggaaagattgatgtactgcaggcagaggtagcagctttgaaaacactagttctctcaacctcaccaacttctcccacaaaagaactacagccagctggaaaggcaccctttaggaagggccatgtcaggaacaaaagcacaagcagtgctatgggtggaggaacactagacctcagtgtactgccaccaattgtcatggaactgaaagagcctgatttatccctttactatgaattcagaacttggaaagaagagccttccatggatagggcatgcccatttttgcacagaatatatcaggaggatatctgcccttgtttaacattccctaaaagtgagctagctgcagctgttcttgaagctgtagaaaacaacaccttaagcattgagcctgctggtcagcaacctgtgcggtttgttaaagcatcagctgttgaatgtggaggatcaaaaaaatgtgcgttaagtggtcagacaaagtcttgtaagcacagaattaaactgggagactccagcaattactattatatttctccttgctgtagatataggattgcatctgtgtgcaatttctttacatatattcggtacatccatcaaggacttttaaaacagcaggatgtttttttttcttcctcttttacagttgatcagatgttttgggaggtcatgcaacttaggaaagaaatgtctcaagcaaaacttggatatttcaaagaggagctttagcacacaacaggaatgctcacaaatgtttcttggacttcttccatgctaggagattgaaagaacattgcagccccaggcttcccctatgccagatactgaaatgactgcataaatcaaactatcaaatatgtatctttcctgtgtactttgcaaattgcacaactaagagataatgtgacatcttatagctaactcccaagagatccccagtgcttgcaggagaaggttagctgttgaggttctaataagcatttgctggcatcatcttgtgtaaattattggtgaactaactcagtatgaagaaataaatggtagttttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MASDPLEGFHEVNLASPTTPDLGVSDVKAHEPTTSPNPIYRPHLTVGSNPIQPNTLNASDLPTQPVYSSPRHLNCGNTTGISPNVTDSISYSTSGCPACSLKHSRKKDNRAEREFLQGATLTDVVDGSDDVLGCSTDSLSRLRSPSVQEVRDRGYERLREELAKAKRDLKLKDEECERLSKVRDQLGQELEELTASLFEEAHKMVREANLKQAAAEKQLKEAQGKIDVLQAEVAALKTLVLSTSPTSPTKELQPAGKAPFRKGHVRNKSTSSAMGGGTLDLSVLPPIVMELKEPDLSLYYEFRTWKEEPSMDRACPFLHRIYQEDICPCLTFPKSELAAAVLEAVENNTLSIEPAGQQPVRFVKASAVECGGSKKCALSGQTKSCKHRIKLGDSSNYYYISPCCRYRIASVCNFFTYIRYIHQGLLKQQDVFFSSSFTVDQMFWEVMQLRKEMSQAKLGYFKEEL
Donor tissue: tadpole