ORFeome > MGC75747 – XORFeome 2.0

MGC75747 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC75747, mRNA (cDNA clone MGC:75747 IMAGE:5381429), complete cds
Gene Symbol: MGC75747
Gene ID: 394789
ORF gb_acc: MG132933
ORF ID: 10300

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC063336

Library Location

Plate ID: GDExt11003
Well Location: B09

EST Sequences

Clone: MGC:75747 IMAGE:5381429
Trimmed Sequence: ATGGATGACAGTGTATTTATCAGTTACTGTGTGGTAACCGGCAGCTTCCTGGGATTCCAACTGCTCTTCTCAATAATCAGCCCCCGAACCTTTACAAAATACTCCAGTACCTACAGACAGCTCAGCTTTGGCAAGCAGTGTGAGTGGGACTCAAGATGTGTTTCCACAACCCACGCGCTAGTCGTTGGATCTGGGTGCCTGTATATTCTGGCGTATGATGAAGCTGTGAATGCTGACCCCATATGGGGTGATCCATTTTGGGTGAAAATGAACGTTGCCATCACTTGCGGCTACCTCGTGCATGATTTACTGCTCCTGGCGCGTTTCTGGAAAGTGATGCGGGACCCGTATATGGTGTGCCACCATCTGGCCGTGTTTTACTCCTACGGATACGTGCTGAATCGCGGGGTGCTGCCGTATTTCGCCAACTTCAGGCTCATTTCAGAACTTTCCACACCCTTTGTAAATCAGAGGTGGTTCTTTGATGTGATTGGGAAGCCCCGCTCCTCCTGGCCGGTCCTGTTGAATGGATTGGCCATGGCCCTAGTCTTTTTCATAGTTCGCATTGCAGTGATCCCCAGCTACTACTCTCAGGTGTTTGCCACTTTTGGCACAGAGGGCTACATCAGACTGGGCATTGGGCCCCAGGTGGCGTGGATTGTGTCCTGTGTGGTCCTAGACATTCTCAATGTATTCTGGATGTACAAGATCGCTCGCGGGTTCTACAAGGTGGTGAAAGCCAAGCCTGACGGGAAGCCGAGGAGGAACCACGCAGACTGA
Full Trace Sequence: ggatggggcagtacctcaactgcctctgctctggagctgcactgctgctgctgcgtgggaacatctctacctaaaaacctgtgaagcttgaaaaatatcacaatggatgacagtgtatttatcagttactgtgtggtaaccggcagcttcctgggattccaactgctcttctcaataatcagcccccgaacctttacaaaatactccagtacctacagacagctcagctttggcaagcagtgtgagtgggactcaagatgtgtttccacaacccacgcgctagtcgttggatctgggtgcctgtatattctggcgtatgatgaagctgtgaatgctgaccccatatggggtgatccattttgggtgaaaatgaacgttgccatcacttgcggctacctcgtgcatgatttactgctcctggcgcgtttctggaaagtgatgcgggacccgtatatggtgtgccaccatctggccgtgttttactcctacggatacgtgctgaatcgcggggtgctgccgtatttcgccaacttcaggctcatttcagaactttccacaccctttgtaaatcagaggtggttctttgatgtgattgggaagccccgctcctcctggccggtcctgttgaatggattggccatggccctagtctttttcatagttcgcattgcagtgatccccagctactactctcaggtgtttgccacttttggcacagagggctacatcagactgggcattgggccccaggtggcgtggattgtgtcctgtgtggtcctagacattctcaatgtattctggatgtacaagatcgctcgcgggttctacaaggtggtgaaagccaagcctgacgggaagccgaggaggaaccacgcagactgagcccactcccttattatggggtgtcctaggcaaatggccaatcacattcatttactgtacatggtgggaacacactgcgtatgtgaggcctcctggatattggccatattcatctcctgtggcagaaacccaatttaggtgcaaattcagtgttacacggaccaacgttggccttggtgcccaagctgggcaagctgctcggcataatagggtcttgccatacaagtgccttagtatggggaaagcagagttcaggaatggacaaatcatatcatgaggggtagggacagcatcgaataaagctttgctttccccgccaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MDDSVFISYCVVTGSFLGFQLLFSIISPRTFTKYSSTYRQLSFGKQCEWDSRCVSTTHALVVGSGCLYILAYDEAVNADPIWGDPFWVKMNVAITCGYLVHDLLLLARFWKVMRDPYMVCHHLAVFYSYGYVLNRGVLPYFANFRLISELSTPFVNQRWFFDVIGKPRSSWPVLLNGLAMALVFFIVRIAVIPSYYSQVFATFGTEGYIRLGIGPQVAWIVSCVVLDILNVFWMYKIARGFYKVVKAKPDGKPRRNHAD
Donor tissue: tadpole