ORFeome > MGC75752 – XORFeome 2.0

MGC75752 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC75752, mRNA (cDNA clone MGC:75752 IMAGE:5381534), complete cds
Gene Symbol: MGC75752
Gene ID: 394820
ORF gb_acc: MG132908
ORF ID: 10273

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC063337

Library Location

Plate ID: GDExt11003
Well Location: H05

EST Sequences

Clone: MGC:75752 IMAGE:5381534
Trimmed Sequence: ATGAGCGCTCAGAGTCAGATCCGCCAGAACTACCATGAGGAAAGCGAGGCTGGAATCAACCGCATTGCCAACCTAGAGCTGCAGACTTCCTATGTCTACCTGTCTCTGGGCTATTACTTCGATCGTGATGATGTGGCTCTTTCCAAGTTCTCAAAGTACTACCGTGAGCTATCTGAGAAGAAGCGGGATCACGCTGAGGATTTACTAAAATTCCAGAACAAGCGTGGGGGGCGCGTTGTGCTCCAAGACATCAAGAAACCTGATGCCGACGAGTGGGGCAATGGGACCAAGGCTATGGAGGTTGCACTCAATCTTGAGAAGAGCGTGAACCAGGCTCTCTTGGACCTGCACAAAATTGCTACAGATCATGCCGATCCACATATGTGTGACTATCTGGAGCGCGAGTTCCTTGAGGAGGAAGTTAAGATCATCAAGAAGCTGGGCGACCACCTTACCAACCTGAAGCGCGTTAAGGCAGCTGAAGATGGCATGGGAGAATATCTCTTTGATAAGCTGACCCTGGGAGACAGTGACTAA
Full Trace Sequence: cttcgcagtcacagcagaaggaatccgcagttcttgcttcaacagtgcttgaacggaactcggcttctccaggctcgaatcgcaagtcgcatatccgcagtcttttttaacactttgccaagtccagcaaaatcgtgacatcatgagcgctcagagtcagatccgccagaactaccatgaggaaagcgaggctggaatcaaccgcattgccaacctagagctgcagacttcctatgtctacctgtctctgggctattacttcgatcgtgatgatgtggctctttccaagttctcaaagtactaccgtgagctatctgagaagaagcgggatcacgctgaggatttactaaaattccagaacaagcgtggggggcgcgttgtgctccaagacatcaagaaacctgatgccgacgagtggggcaatgggaccaaggctatggaggttgcactcaatcttgagaagagcgtgaaccaggctctcttggacctgcacaaaattgctacagatcatgccgatccacatatgtgtgactatctggagcgcgagttccttgaggaggaagttaagatcatcaagaagctgggcgaccaccttaccaacctgaagcgcgttaaggcagctgaagatggcatgggagaatatctctttgataagctgaccctgggagacagtgactaagtcctgtcactaaaatgtgtggggtgcatattctgcctggccagtcgcccctccttcccgcttcttactattgctcattaattggaatccaaagttgaaatgtgatctctggaatgtgatttgcttgctatctgcacataagcaaaatacaactttactagcagcattaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSAQSQIRQNYHEESEAGINRIANLELQTSYVYLSLGYYFDRDDVALSKFSKYYRELSEKKRDHAEDLLKFQNKRGGRVVLQDIKKPDADEWGNGTKAMEVALNLEKSVNQALLDLHKIATDHADPHMCDYLEREFLEEEVKIIKKLGDHLTNLKRVKAAEDGMGEYLFDKLTLGDSD
Donor tissue: tadpole