ORFeome > MGC75753 – XORFeome 2.0

MGC75753 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC75753, mRNA (cDNA clone MGC:75753 IMAGE:5381548), complete cds
Gene Symbol: MGC75753
Gene ID: 394487
ORF gb_acc: MG132943
ORF ID: 10317

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC059748

Library Location

Plate ID: GDExt11004
Well Location: H01

EST Sequences

Clone: MGC:75753 IMAGE:5381548
Trimmed Sequence: ATGATGACTGAGATCTCAACAGCTGCTGCGTTTATCACAAGTTTGCTGAAAACAACCGGGGTCATAGAGGAGAGGCAGCTGCAGCACTTCTGCCAGGTCCTACAGGAGGCCATGAAGGATCATTATAAACACCACTGGTTTCCGCAGAACCCTTTCAAAGGATCAGGGTACCGTTGCTTGAGAATTAACCACAAAATGGACCCCTTGATAGGACAGGCAGCAGGTCACATTGGGCTCAGCCACCAGAGACTGTTCCAGCTTCTCCCCAGCGAGCTGACTCTTTGGGTTGACCCTTTTGAAGTCTCCTATCGCATTGGTGAGGATGGGTCCATCTGTGTATTGTATGAAGGAGCCGCAGCAGGGGGCAAGCCTATTGAAAACCATGCAAGCTGCAAGGATGCACTTAGAATTGGCCGGAATAGCCCCTCCAAAAATTACAGCATAATGACAGTTTCTAGTTAA
Full Trace Sequence: aagagagagacccgctgctgttgatgtttatatagctgtgaggattcaaccttatatgccacaatgatgactgagatctcaacagctgctgcgtttatcacaagtttgctgaaaacaaccggggtcatagaggagaggcagctgcagcacttctgccaggtcctacaggaggccatgaaggatcattataaacaccactggtttccgcagaaccctttcaaaggatcagggtaccgttgcttgagaattaaccacaaaatggaccccttgataggacaggcagcaggtcacattgggctcagccaccagagactgttccagcttctccccagcgagctgactctttgggttgacccttttgaagtctcctatcgcattggtgaggatgggtccatctgtgtattgtatgaaggagccgcagcagggggcaagcctattgaaaaccatgcaagctgcaaggatgcacttagaattggccggaatagcccctccaaaaattacagcataatgacagtttctagttaaacagctgaaaaataaatcaggaattgtacaattacgtatgtgtccctcttctgccttgatttgcgttaatgtttcatcttcattccataaacattaaaactgtaatactgccaaaaatgtaccgtcttgttgcagaaggtgaatgtagaataccatctggggcaaaaagctcttattgtcatttctgtctttcttttatgacattttctcgctccggtctctgaaattgtacattgtaaaatgaaatcatgagtcaagagagaatttatattttggtataaccattggctctttttaataaaaagaaaaactattttaaaaaaaaaaaaaaaaaa
Translation: MMTEISTAAAFITSLLKTTGVIEERQLQHFCQVLQEAMKDHYKHHWFPQNPFKGSGYRCLRINHKMDPLIGQAAGHIGLSHQRLFQLLPSELTLWVDPFEVSYRIGEDGSICVLYEGAAAGGKPIENHASCKDALRIGRNSPSKNYSIMTVSS
Donor tissue: tadpole