ORFeome > MGC75755 – XORFeome 2.0

MGC75755 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC75755, mRNA (cDNA clone MGC:75755 IMAGE:5381573), complete cds
Gene Symbol: MGC75755
Gene ID: 394666
ORF gb_acc: MG132944
ORF ID: 10318

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061290

Library Location

Plate ID: GDExt11004
Well Location: H02

EST Sequences

Clone: MGC:75755 IMAGE:5381573
Trimmed Sequence: ATGCCCCCTGTACCCAGTGATCCTGTGCTCTTAGATCTGGAAATTCTGAAGGACAGGTGCTCCCATGGCAAAACCTACTGCCAACAGCTGCTGTGTCTTTACGAGTTAAGCCAGGACCTGGGATGTTCCTTCTCAGATATCTCCTCTCGAGATCCAGGCGAGATTCTACGCTCTCTGCTTTCTTCTCAGCGTCCCGAGCTCACAGACAGAGCACAAGCAGTCATCAACTTCCACGGACTGTCGCCCCAAACAGTGGCACAGATTGTGGCAGAAGAGGGTGTGAGAGTCTGGCGGGCAGGGCCCGTGGAAGTTTATAATGCCTCTGAAATAAGGCAGCGCTTTTTGCAGCTTGTAAAACTTTGCCAGGACCCAACTCTGGTTGGATTAACGCTACTTGACTATCTAGAAAATGTGCCACTGACTGAGCAACACTGCATTATTGAACTCCTGATTTCTGCCCACGATTGCTTCAGTTTAACGTGCCATCTTGAAGGAATTCGACGGGTGCTTCAGGCATGTCGACACCTAACCGAGAGTCACTTGGCGGCTAACCAAGAATACAGCCTTATGGTTCGCCTACTCTCTGGGATTGGTCGTTATAATGAGATGGTTTATGTGTTTGACATTCTGCACAAGGAACAGCACTTTGAGGTTCTGCTGAGGAAACAGCTAGATACAAAGGGGGGACTGCAGACTGCTCTTTTGGAATACATTAAGCGCTGCCATCCAGGAGACAGCGAGAAGCACAACATGACTGCGCTCTGCTTCAGTTTGCACCGTGACATTGGCCACAACCATGAGCAGGCAGCTTTGATCCAGCTCAAACTCATCCAGTCTAGGGCATGGGAATACTGGATGTCTGAATTGGTGGAGTTGAGATCTGCACTAATGAAAGCACTTACTCTCCTAATAGATGCAGCTGAGAGCTACTCAAAGGATTCCTGCGTCCGTCAGTCTCTGCGCTGTGCTCGCCTTACCCGTCTGTTGACTCTGCAGCTTCATCTGCTAAACAACAGTCATCAAACTAAATTAATCAACCTGGATAGAGAGAACTTGATGGAGCCAATACTGGAACTGCCACGTTTCTACCAGGCAGTCATTGTTACAGAGGCCTATGATATACAGCCAGACTGGGCAGAGGTTTTATATCACAAGGTGATTCTTGCTGGAGACTTTCAGTATTTAAATGAATTCAAGCAGCGAGAACTGCTACGGAGTGGAGTGTTCCAGCAACTGTCTGACAAGTGTAAATTACAGCCTCCAGGAGCTACCGGACTTCAAAATCTGAAGAGAGTGCTCGGTTACTGCGAAGATACCTATACCCGCTACAAACTGGCCTTGGAAAATCAGTTCTATGATGTGACCGATGTTTTAATGAGAGACTCACAAACCCGCTGCTGCCTGACTGACATGCTGTCTCGGTAG
Full Trace Sequence: aaaaaaaaaaaaaacccttcaaacttgtgacttgatttattttgtccttagcctcttctctggacaccgccatgccccctgtacccagtgatcctgtgctcttagatctggaaattctgaaggacaggtgctcccatggcaaaacctactgccaacagctgctgtgtctttacgagttaagccaggacctgggatgttccttctcagatatctcctctcgagatccaggcgagattctacgctctctgctttcttctcagcgtcccgagctcacagacagagcacaagcagtcatcaacttccacggactgtcgccccaaacagtggcacagattgtggcagaagagggtgtgagagtctggcgggcagggcccgtggaagtttataatgcctctgaaataaggcagcgctttttgcagcttgtaaaactttgccaggacccaactctggttggattaacgctacttgactatctagaaaatgtgccactgactgagcaacactgcattattgaactcctgatttctgcccacgattgcttcagtttaacgtgccatcttgaaggaattcgacgggtgcttcaggcatgtcgacacctaaccgagagtcacttggcggctaaccaagaatacagccttatggttcgcctactctctgggattggtcgttataatgagatggtttatgtgtttgacattctgcacaaggaacagcactttgaggttctgctgaggaaacagctagatacaaaggggggactgcagactgctcttttggaatacattaagcgctgccatccaggagacagcgagaagcacaacatgactgcgctctgcttcagtttgcaccgtgacattggccacaaccatgagcaggcagctttgatccagctcaaactcatccagtctagggcatgggaatactggatgtctgaattggtggagttgagatctgcactaatgaaagcacttactctcctaatagatgcagctgagagctactcaaaggattcctgcgtccgtcagtctctgcgctgtgctcgccttacccgtctgttgactctgcagcttcatctgctaaacaacagtcatcaaactaaattaatcaacctggatagagagaacttgatggagccaatactggaactgccacgtttctaccaggcagtcattgttacagaggcctatgatatacagccagactgggcagaggttttatatcacaaggtgattcttgctggagactttcagtatttaaatgaattcaagcagcgagaactgctacggagtggagtgttccagcaactgtctgacaagtgtaaattacagcctccaggagctaccggacttcaaaatctgaagagagtgctcggttactgcgaagatacctatacccgctacaaactggccttggaaaatcagttctatgatgtgaccgatgttttaatgagagactcacaaacccgctgctgcctgactgacatgctgtctcggtagaagacagggcaaaatggaaggataacactgaggcacaaatgtgaatatgccatgacattgtttgttacatgaacagtttgaaatggcttagctggctaagtgtccaaactgctgtcttatatctctttctttgccacaaggggcttttatttgccctcatctctggtatttggagcttattaaatgttaatatcttcttaagaacaaccataaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MPPVPSDPVLLDLEILKDRCSHGKTYCQQLLCLYELSQDLGCSFSDISSRDPGEILRSLLSSQRPELTDRAQAVINFHGLSPQTVAQIVAEEGVRVWRAGPVEVYNASEIRQRFLQLVKLCQDPTLVGLTLLDYLENVPLTEQHCIIELLISAHDCFSLTCHLEGIRRVLQACRHLTESHLAANQEYSLMVRLLSGIGRYNEMVYVFDILHKEQHFEVLLRKQLDTKGGLQTALLEYIKRCHPGDSEKHNMTALCFSLHRDIGHNHEQAALIQLKLIQSRAWEYWMSELVELRSALMKALTLLIDAAESYSKDSCVRQSLRCARLTRLLTLQLHLLNNSHQTKLINLDRENLMEPILELPRFYQAVIVTEAYDIQPDWAEVLYHKVILAGDFQYLNEFKQRELLRSGVFQQLSDKCKLQPPGATGLQNLKRVLGYCEDTYTRYKLALENQFYDVTDVLMRDSQTRCCLTDMLSR
Donor tissue: tadpole