ORFeome > MGC75760 – XORFeome 2.0

MGC75760 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC75760, mRNA (cDNA clone MGC:75760 IMAGE:5381643), complete cds
Gene Symbol: MGC75760
Gene ID: 394486
ORF gb_acc: MG132912
ORF ID: 10278

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC059753

Library Location

Plate ID: GDExt11003
Well Location: E10

EST Sequences

Clone: MGC:75760 IMAGE:5381643
Trimmed Sequence: ATGGCAGAAACTGTGAAGATACTGAGTGGAGGGCTGTCAACTGAACTGGAGAACTCTGGCTTTTTGCTGCAGGGGGACCCACTTTGGAGTGCCAGGCTTCTTCAAACTAATCCTCAGGCTATAAAGAATGTGCACACAAGTTTCCTCAAGAGTGGTGCAGAAGTCCTGAGTACTGCAACTTATCAGGCCAGTGTTAAAGGTTTCCAAGAACATCTTGGGCTCAGCATAGATGAAGTGGCAGAACTTTTCCATGTAGGAGTGAGATTAGCTAAAGAGGCTGCTGCTGAAATTAAAGACAATAGAAACATTTTAATTGCTGGATCTATAGGGCCATATGGTGCATTTCTAAGTGATGGCTCAGAGTACACAGGAAACTACCTGAGAAACATGTCTGTTGAGGAATTAAAGGACTGGCACAGGTTGCAGATGCAATGTTTGGCTTCTGCTGGAATTGAGCTGTTTGCTTTGGAGACAATACCTGGCCAAAAGGAAGCTGAAGCCCTCCTGGAGCTACTAAGGGAGTTTCCAAATACAAATGCTTGGCTTTCCTATTCCTGCCGGGATATGTCTTCTACCAGCTATGGAGATGCATTTGAGAAGGCTGTGGGAATTGCTCATAAATCAAAGCAACTAGTGGCTGTGGGGATGAACTGCTGCCCTCCTACTTTTGTTAGTTCACTACTAACTTCTGCTAACAAAAACCGAGGACTTGACATCGGGTGGATTGTGTATCCCAATAGCGGAAAAATATGGGATCATAACTTGGGTTGGCAAGGTGGCGGTACAGAAAAAACATTATCTGAATACGCTCTGGAATGGGTTAATCTAGGTGCAAAATGGATTGGAGGCTGCTGCACGACAACTCCTTCAGCCATTGCAACCTTGCTTCAGACTCTGAGGCCACACGCTGCAGATCTACATTAA
Full Trace Sequence: ctggggaggtaaacagagaacagagctgctatagctagaggacatattgagctctagagttaaaagctaacatcaagatcatggcagaaactgtgaagatactgagtggagggctgtcaactgaactggagaactctggctttttgctgcagggggacccactttggagtgccaggcttcttcaaactaatcctcaggctataaagaatgtgcacacaagtttcctcaagagtggtgcagaagtcctgagtactgcaacttatcaggccagtgttaaaggtttccaagaacatcttgggctcagcatagatgaagtggcagaacttttccatgtaggagtgagattagctaaagaggctgctgctgaaattaaagacaatagaaacattttaattgctggatctatagggccatatggtgcatttctaagtgatggctcagagtacacaggaaactacctgagaaacatgtctgttgaggaattaaaggactggcacaggttgcagatgcaatgtttggcttctgctggaattgagctgtttgctttggagacaatacctggccaaaaggaagctgaagccctcctggagctactaagggagtttccaaatacaaatgcttggctttcctattcctgccgggatatgtcttctaccagctatggagatgcatttgagaaggctgtgggaattgctcataaatcaaagcaactagtggctgtggggatgaactgctgccctcctacttttgttagttcactactaacttctgctaacaaaaaccgaggacttgacatcgggtggattgtgtatcccaatagcggaaaaatatgggatcataacttgggttggcaaggtggcggtacagaaaaaacattatctgaatacgctctggaatgggttaatctaggtgcaaaatggattggaggctgctgcacgacaactccttcagccattgcaaccttgcttcagactctgaggccacacgctgcagatctacattaatgtacttctttctccccttttgccaatattcttaattacattgttattaataaaccgtgatctctttctaactaaaaaaaaaaaaaaa
Translation: MAETVKILSGGLSTELENSGFLLQGDPLWSARLLQTNPQAIKNVHTSFLKSGAEVLSTATYQASVKGFQEHLGLSIDEVAELFHVGVRLAKEAAAEIKDNRNILIAGSIGPYGAFLSDGSEYTGNYLRNMSVEELKDWHRLQMQCLASAGIELFALETIPGQKEAEALLELLREFPNTNAWLSYSCRDMSSTSYGDAFEKAVGIAHKSKQLVAVGMNCCPPTFVSSLLTSANKNRGLDIGWIVYPNSGKIWDHNLGWQGGGTEKTLSEYALEWVNLGAKWIGGCCTTTPSAIATLLQTLRPHAADLH
Donor tissue: tadpole