ORFeome > MGC75772 – XORFeome 2.0

MGC75772 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC75772, mRNA (cDNA clone MGC:75772 IMAGE:5381849), complete cds
Gene Symbol: MGC75772
Gene ID: 394663
ORF gb_acc:
ORF ID: 10316

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061300

Library Location

Plate ID: GDExt11003
Well Location: F12

EST Sequences

Clone: MGC:75772 IMAGE:5381849
Trimmed Sequence: ATGGCCGCGGCTCCGGGGTTGGCGGCTTTCTGCCGGAAGGTATGGGAGCCGGTGGTGGCGAAAGCCCGCAGAGCTGTGGTGTTCATCGACCAGCCTTGCGCCGAGGTGCTGCACTGGTGCGGGGGGGCAGAACTACTGCTTGCGGCGGGGGCTTTGAATGTAAAGGAATTCTCCAGCTTCGAGTCCGGCGGCTCCAAGCAGCCCAAAGCTTTGTTCGTGGTGAGCTGCCCGCTGCGTGGCCGGGCTTTGGAGGTGATTAAGGACGTAGTGAGCCAGAGCTCCTTCCAATACTGCATAGTGGTGACAGCTGTGAGCCCGTCTGAAGCTGCCGATGCCCGAACCCTATGTGAGCAGATGGAGGACAAGCTGTGCGAATGGATGGGAAACATGAACTTTACAGCGGAGGTGATGTGGGCTCCCCTGATGCTGGCCCCTCTGTCCCCCCACCTGTTAGTAGCCCCAGCTTTCTCTTCCCTATTCCCTCTCCTGCCATCCCAAGACCTGCACACACTAAACCTCGGCCGAGCAGACAAAAAGAGGTTCCCAGGACTTGGAGATGTGGATCTTCCCTCCATGCCCCAGGAGCTCCAGCTGCACATAAGAAACCTGCTGTCAGGGCTCAACCAGTTCTTGGAAGGCATAGGTGTGCGGGAGGAGTGCTACTCAGTGGGGCATCTCAGCCGGATTATTGCTGGAGAGCTGGCTAATTACCCCCTGGCTAAGAACCGCAGGAAAACTGCCCAGAGCAAAGCCTCCCTGGTCTTCATTGACAGGACTATGGACTTGGCTGGTATGGGAACAATCTCCAGACTTTTCTTTTTGGGTCTTAAAGTTTTCTCGCTAAAGAATTTGTTTTTATTTGATTCATTAGATTTGCTAAATAAAATTAAATATCTATGA
Full Trace Sequence: cagtgagaagaagggttctgtttgtgcgttccaatggccgcggctccggggttggcggctttctgccggaaggtatgggagccggtggtggcgaaagcccgcagagctgtggtgttcatcgaccagccttgcgccgaggtgctgcactggtgcgggggggcagaactactgcttgcggcgggggctttgaatgtaaaggaattctccagcttcgagtccggcggctccaagcagcccaaagctttgttcgtggtgagctgcccgctgcgtggccgggctttggaggtgattaaggacgtagtgagccagagctccttccaatactgcatagtggtgacagctgtgagcccgtctgaagctgccgatgcccgaaccctatgtgagcagatggaggacaagctgtgcgaatggatgggaaacatgaactttacagcggaggtgatgtgggctcccctgatgctggcccctctgtccccccacctgttagtagccccagctttctcttccctattccctctcctgccatcccaagacctgcacacactaaacctcggccgagcagacaaaaagaggttcccaggacttggagatgtggatcttccctccatgccccaggagctccagctgcacataagaaacctgctgtcagggctcaaccagttcttggaaggcataggtgtgcgggaggagtgctactcagtggggcatctcagccggattattgctggagagctggctaattaccccctggctaagaaccgcaggaaaactgcccagagcaaagcctccctggtcttcattgacaggactatggacttggctggtatgggaacaatctccagacttttctttttgggtcttaaagttttctcgctaaagaatttgtttttatttgattcattagatttgctaaataaaattaaatatctatgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAAAPGLAAFCRKVWEPVVAKARRAVVFIDQPCAEVLHWCGGAELLLAAGALNVKEFSSFESGGSKQPKALFVVSCPLRGRALEVIKDVVSQSSFQYCIVVTAVSPSEAADARTLCEQMEDKLCEWMGNMNFTAEVMWAPLMLAPLSPHLLVAPAFSSLFPLLPSQDLHTLNLGRADKKRFPGLGDVDLPSMPQELQLHIRNLLSGLNQFLEGIGVREECYSVGHLSRIIAGELANYPLAKNRRKTAQSKASLVFIDRTMDLAGMGTISRLFFLGLKVFSLKNLFLFDSLDLLNKIKYL
Donor tissue: tadpole