ORFeome > MGC75785 – XORFeome 2.0

MGC75785 – XORFeome 2.0

General Information

Species: Xenopus tropicalis high-mobility group nucleosome binding domain 1, mRNA (cDNA clone MGC:75785 IMAGE:5381994), complete cds
Gene Symbol: MGC75785
Gene ID: 394660
ORF gb_acc: MG132955
ORF ID: 10331

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061309

Library Location

Plate ID: GDExt11004
Well Location: A04

EST Sequences

Clone: MGC:75785 IMAGE:5381994
Trimmed Sequence: ATGCCTAAGAGAAAGCAGGTGAATGCTGCTGATGCTGCAGATGCCAAGGATGAGCCCAAGAGGAGATCGGCACGGTTGTCGGCTAAACCAGCCCCACCAAAAGCTGAACCAAAGCCAAAAAAAGACAAGGCACCCGTAAAGGAAAAGCCTGAGGAGAAGGAGAAAAAAGTTCCAGCAAAGGGTAAAAAGGGAGCAAAGGGCAAACAGACAGAGGAAGCTAACAAAGAAGAAGCTAAGGAAGACCAGCCGTCTGAAAACGGAGAAACAAAAAGTGACGAGGCCCCTGCTTCTGATGGAGGCGACAAGGAATCAAAGTCTGAATAA
Full Trace Sequence: ctgcaggagggctcgcacatagaaaaaacaaatatatatataaataagtgcaagcaagccagggatttaagtgtgtaggcgtccatttgcagagaaggctgctaagcgttcccgttgcttctgtctttggattcaagcggtgcacacaagccctcagtgcagccatgcctaagagaaagcaggtgaatgctgctgatgctgcagatgccaaggatgagcccaagaggagatcggcacggttgtcggctaaaccagccccaccaaaagctgaaccaaagccaaaaaaagacaaggcacccgtaaaggaaaagcctgaggagaaggagaaaaaagttccagcaaagggtaaaaagggagcaaagggcaaacagacagaggaagctaacaaagaagaagctaaggaagaccagccgtctgaaaacggagaaacaaaaagtgacgaggcccctgcttctgatggaggcgacaaggaatcaaagtctgaataaccttcatcttgtaccgagtcttttatcagtggttcctgtacctcccttgtacaattcagaggaatatttttatcaactattttgtaaatgcaagttttttagtagtttaattctagaaaacacatttttaaaataggagggaatccccaccatttttttgttgtaaaaaaaattttttttaaacacttatgatttggtacattgcccctgtatggtttgtaaaggctatgaatactataccagttaatactacaccacaaaccagttactgtggggagtgcaagccttgagcagtctaaaatgttttttttattttgttacaaaacggctagtactctatgcaggctgccggtcgaacaggcagtgcccgatactggtacaactggcgcaaagatcacggctattaaaatgtcttaacgttttaactgttctttgtactcatgttgtcctgcgtacaatttacacttttaaactaataaatctcccaaggtgacggatttccctctaaacaaaaaaaaaaaaaaaaaaaaaaa
Translation: MPKRKQVNAADAADAKDEPKRRSARLSAKPAPPKAEPKPKKDKAPVKEKPEEKEKKVPAKGKKGAKGKQTEEANKEEAKEDQPSENGETKSDEAPASDGGDKESKSE
Donor tissue: tadpole