ORFeome > MGC75793 – XORFeome 2.0

MGC75793 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC75793, mRNA (cDNA clone MGC:75793 IMAGE:5382176), complete cds
Gene Symbol: MGC75793
Gene ID: 394658
ORF gb_acc: MG132901
ORF ID: 10266

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061314

Library Location

Plate ID: GDExt11003
Well Location: D10

EST Sequences

Clone: MGC:75793 IMAGE:5382176
Trimmed Sequence: ATGGCAGAGGTTGCCCAGATGCTGCGGGAACTAGGGTACAAAGGTCCACTATGTTGTGAAAAAGAACTGGAACGTTCAGCAAAACTGGGTGCTGCCAGCCAACATTTCACGGCTCTCTGTGCCTGGCTAGTTTCCGAACTCAAGGTTGTGTCCTCGATGGTGGAGAACATCAGCCCTACAGAGGGGCCTGAGGATGCAGAGACCTTCCAGCTAGAGATGAGTGGTGTGGTAAATGAACTTCACTGTCCTTACACTGCATTGACTACAGGGGATGTGACCTGCAGACTGACCAACCTCGATAACTGCCTGCAGCTCCTTGTGTTTCTCAGTACAGAGCTTCAGGCTGCAAGGATAATATCTAACAGGAAGGTCCCAGTTATAGGCTCAGAAAAAGGCAACACAGAAGCCATACAGGAACTGAAGTGGGTCGGGGCAACTCTAGGTATTCAAGAATACTTACTTGGTGTCCCAGTAGCTGAGTACATGCGGATACTGCAGAACAAGATTGCCGAGATTACAGCTGCCCTTCCAGATTCTTCATGGTCTTCCCCTCTTTTGAAAACAGAACTGCAACCTTCACAATGGGAGAAGCTAGCAGATCTACACTGTCAGCTGCTTGGAGAGTATGAATGCAGAATGAGGATGCTGGTCACTCGATTTGATGTCACAGTGCAATCGTTCTACTGGTCTGAGAGAGCAAAGGAACTTGGAGCTGCTATGAAGGAGGTTTTTTGGCCTCTGCGCCAGTCTCTGAAGACGGAGTCCGATATAAACATGGCCCATCTCCTGGCTGCACGAGAAGAAGATTCTCGAATCCTTCACACATGCAGTGCTGTCTTTCGCCAAAATACTCAAAGCTCCATCAACAAGGTTCTCATGACAGGGAATGTGCCAGATCGAGGAGGCCGCCCCAATGAAATAGAGCCTCCAATGCCCACGTGGACAAAGCGCAAAGAAGGGGGAGGAGGGCAGCAGTGGTGGGGAAAACGCAATAAAAGGAGGAAAAAGTAA
Full Trace Sequence: ccccgccccactctgtgccgctgcccacaacctccccccagcagcaccgccaccggcccaaacctcacactgaacgctgactgcgatatctgtggaacctacgttggcggcctccgtatgttgcttggcaactacaggaagtataggccctgattagaatgtcgtggtagaatggagaacggagcgcaggttggagtgttgttggtagcgcctgagactttgcacgaagcaaacgaggaaaggcctaacaacggtgggatagaattggcagccgagagtggtattataatccctcagggcagcacttgggcggaaggagcacgcatggcagaggttgcccagatgctgcgggaactagggtacaaaggtccactatgttgtgaaaaagaactggaacgttcagcaaaactgggtgctgccagccaacatttcacggctctctgtgcctggctagtttccgaactcaaggttgtgtcctcgatggtggagaacatcagccctacagaggggcctgaggatgcagagaccttccagctagagatgagtggtgtggtaaatgaacttcactgtccttacactgcattgactacaggggatgtgacctgcagactgaccaacctcgataactgcctgcagctccttgtgtttctcagtacagagcttcaggctgcaaggataatatctaacaggaaggtcccagttataggctcagaaaaaggcaacacagaagccatacaggaactgaagtgggtcggggcaactctaggtattcaagaatacttacttggtgtcccagtagctgagtacatgcggatactgcagaacaagattgccgagattacagctgcccttccagattcttcatggtcttcccctcttttgaaaacagaactgcaaccttcacaatgggagaagctagcagatctacactgtcagctgcttggagagtatgaatgcagaatgaggatgctggtcactcgatttgatgtcacagtgcaatcgttctactggtctgagagagcaaaggaacttggagctgctatgaaggaggttttttggcctctgcgccagtctctgaagacggagtccgatataaacatggcccatctcctggctgcacgagaagaagattctcgaatccttcacacatgcagtgctgtctttcgccaaaatactcaaagctccatcaacaaggttctcatgacagggaatgtgccagatcgaggaggccgccccaatgaaatagagcctccaatgcccacgtggacaaagcgcaaagaagggggaggagggcagcagtggtggggaaaacgcaataaaaggaggaaaaagtaatggtgattggttagacctggtgtaaaataaaaagatgaaattaaaaaaacagagcaatacttgctcagaaacacagtgttaatagtaaggccctagcttcctttgtcatccttcttgtaccataacttaagcaaacatattctgtaagtgtgcatgacttctggtcaaagtgtatggatatttttggataaggatggataagaagctttaattttgcaaatataggatatatttttccagaaaacaagtttaatgcatttaaaatgggtggagtgcaattactgagtatgtatgcaattttgtttaattatttttggacataagttcccttttgcccagcagagggcaccaaatgaattcttatattagtttatagaactaaagttgtggaatgtctcatttttggtttaatgttcctgagcataataattctcatgtattttttttttttgccaccataaatatgtgcatatgaaagtgattaaactgattaaagtggaaaaaaaaaaaaaaataaaacaattaaaacaacaataaaaaaaaaaaaaaaaaaaaaaa
Translation: MAEVAQMLRELGYKGPLCCEKELERSAKLGAASQHFTALCAWLVSELKVVSSMVENISPTEGPEDAETFQLEMSGVVNELHCPYTALTTGDVTCRLTNLDNCLQLLVFLSTELQAARIISNRKVPVIGSEKGNTEAIQELKWVGATLGIQEYLLGVPVAEYMRILQNKIAEITAALPDSSWSSPLLKTELQPSQWEKLADLHCQLLGEYECRMRMLVTRFDVTVQSFYWSERAKELGAAMKEVFWPLRQSLKTESDINMAHLLAAREEDSRILHTCSAVFRQNTQSSINKVLMTGNVPDRGGRPNEIEPPMPTWTKRKEGGGGQQWWGKRNKRRKK
Donor tissue: neurula