ORFeome > MGC75796 – XORFeome 2.0

MGC75796 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC75796, mRNA (cDNA clone MGC:75796 IMAGE:5382200), complete cds
Gene Symbol: MGC75796
Gene ID: 394787
ORF gb_acc: MG132902
ORF ID: 10267

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC063341

Library Location

Plate ID: GDExt11003
Well Location: C11

EST Sequences

Clone: MGC:75796 IMAGE:5382200
Trimmed Sequence: ATGAAGGTCTGCTATAAATCCACTACCGGTGTTTGCTTCTTAATATTTTACCTGATGGTCATTGTCAGCGGAGGGCGTGATTTTTATAAAATCTTGGGTGTGTCAAAAGGAGCTACTGTAAAGGAGATAAAGAAGGCTTATCGAAAGCTTGCCTTGCAGCTTCATCCAGACAGAAACCCTGATGATCCTAATGCACAAGAAAAATTTCAAGACTTGGGGGCTGCCTATGAGGTGCTTTCAGATGAAGAAAAAAGAAAGCAATATGATACATATGGCGAAGAGGGGTTAAAAGATGGACATCAAAGCTCCCATGGTGATATATTTTCTCACTTCTTTGGAGATTTTGGGTTCATGTTTGGAGGCAATCCACGACAACAAGACAGAAATATACCACGAGGTAGTGATATTATTGTTGATTTAGAAGTGACATTGGAAGAGGTATACTCTGGAAACTTTGTAGAAGTTATAAGGAACAAACCCGTAGCTCGACAGGCACCAGGCAAACGTAAATGTAATTGTCGCCAAGAGATGAGAACTACACAGCTGGGTCCTGGACGCTTTCAGATGACACAAGAGGTTGTGTGTGATGAGTGCCCAAATGTGAAACTTGTAAATGAGGAGAGAACATTAGAAGTGGAGATTGAGCCAGGAGTTCGAGACAGCATGGAGTACCCCTTCATTGGAGAAGGAGAACCCCATATTGATGGAGAGCCAGGGGACTTGCGTTTTCGAATTAAAGTTCTCAAGCACCCCATATTTGAAAGAAGAGGAGATGATCTTTATACAAATGTTTCCATCTCTTTAGTTGAAGCTCTTACAGGCTTTGAAATGGATATCGCTCATTTGGATGGTCATAAGGTTCACATATTGCGGGATAAAATTACTAAGCCAGGAGCAAAATTGTGGAAAAAAGGGGAAGGTTTGCCAAACTTTGACAATAACAACATAAAAGGTTCTTTAATTATAACATTTGATGTTGAATTCCCAAAAGAACAGCTAACGATGGAGCAACGACAAGGTGTGAAACAATTAATGAAGCAAAACTCAATACAAAGGATTTACAATGGGCTGCAAGGATATTGA
Full Trace Sequence: gttcctcgtatctgaatcatgaaggtctgctataaatccactaccggtgtttgcttcttaatattttacctgatggtcattgtcagcggagggcgtgatttttataaaatcttgggtgtgtcaaaaggagctactgtaaaggagataaagaaggcttatcgaaagcttgccttgcagcttcatccagacagaaaccctgatgatcctaatgcacaagaaaaatttcaagacttgggggctgcctatgaggtgctttcagatgaagaaaaaagaaagcaatatgatacatatggcgaagaggggttaaaagatggacatcaaagctcccatggtgatatattttctcacttctttggagattttgggttcatgtttggaggcaatccacgacaacaagacagaaatataccacgaggtagtgatattattgttgatttagaagtgacattggaagaggtatactctggaaactttgtagaagttataaggaacaaacccgtagctcgacaggcaccaggcaaacgtaaatgtaattgtcgccaagagatgagaactacacagctgggtcctggacgctttcagatgacacaagaggttgtgtgtgatgagtgcccaaatgtgaaacttgtaaatgaggagagaacattagaagtggagattgagccaggagttcgagacagcatggagtaccccttcattggagaaggagaaccccatattgatggagagccaggggacttgcgttttcgaattaaagttctcaagcaccccatatttgaaagaagaggagatgatctttatacaaatgtttccatctctttagttgaagctcttacaggctttgaaatggatatcgctcatttggatggtcataaggttcacatattgcgggataaaattactaagccaggagcaaaattgtggaaaaaaggggaaggtttgccaaactttgacaataacaacataaaaggttctttaattataacatttgatgttgaattcccaaaagaacagctaacgatggagcaacgacaaggtgtgaaacaattaatgaagcaaaactcaatacaaaggatttacaatgggctgcaaggatattgatgaaagatttaaatattgggaatttttggccttatttgtttgtgcttttgtttcttttataataaatgtcacaactatttactctgaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MKVCYKSTTGVCFLIFYLMVIVSGGRDFYKILGVSKGATVKEIKKAYRKLALQLHPDRNPDDPNAQEKFQDLGAAYEVLSDEEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGNPRQQDRNIPRGSDIIVDLEVTLEEVYSGNFVEVIRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNVKLVNEERTLEVEIEPGVRDSMEYPFIGEGEPHIDGEPGDLRFRIKVLKHPIFERRGDDLYTNVSISLVEALTGFEMDIAHLDGHKVHILRDKITKPGAKLWKKGEGLPNFDNNNIKGSLIITFDVEFPKEQLTMEQRQGVKQLMKQNSIQRIYNGLQGY
Donor tissue: neurula