ORFeome > MGC75803 – XORFeome 2.0

MGC75803 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC75803, mRNA (cDNA clone MGC:75803 IMAGE:5382250), complete cds
Gene Symbol: MGC75803
Gene ID: 394583
ORF gb_acc: MG132904
ORF ID: 10269

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061319

Library Location

Plate ID: GDExt11004
Well Location: D01

EST Sequences

Clone: MGC:75803 IMAGE:5382250
Trimmed Sequence: ATGGCAGATGACTTTTCGTTGGAGGAAGCTTTGCCTTCACAAAGTGCAGCAAACGCCCAGCATTCCCAGGGTCAGGAGCAAGGCCAGCCACCCCAACAGCCCTGGCAATGGGGCAACCCTCCACCAGGCCAGTATCCTTTTCCAGGTCCTTATCCAGGTTATCCTGGTGCTGCACCTAGCCAACAATATCCAGGACCATTTCCTGGCCAACAGTATCCAGGTTTCCCTCCACCAGGCCAGGGATACCCAGGTTTCCCTGCACCAGGCCAGGGAAACCCAGGATTCCCTGCACAAGATCCACAAAAACCTGGAGCTCCAGGGCAGCCTGAATATCCTGCTCCATCTGCTCTAGTTCAGCTAAAAGTTCCGTATGAACTTCCTCTGCCATCTGGGGTTGTACACCGTCTAGTGATCACAATTCATGGCACAGTTAACCCAAATGCAAAGAGATTTGCCATTGACTTCAGAAGAGGCCATGATATTGCCATGCACATCAACCCACGTTTTGATGAAAGACCCCATGTTATTGTGCGCAATTCAATGATCCATAACAAATGGGGACATGAAGAGCGACATGCTCAAAAGTTTCCATTCGTAGCAGGCCAGCCTTTTAAGCTCCAAGTCATGTGTGAAGCTGACCATTACAAAGTGGCTATAAACAACGAAACTCTTTTCCAGTACGTCCACAGGGTGAAGGAGCTACATGAAATCAGGAGTGTGTGTATTGCTGGTGATGTTACTTTAAATGAGGTTACTCCTTCCATGGCCTGA
Full Trace Sequence: gaatctccccccgctcacccgcaaccatggcagatgacttttcgttggaggaagctttgccttcacaaagtgcagcaaacgcccagcattcccagggtcaggagcaaggccagccaccccaacagccctggcaatggggcaaccctccaccaggccagtatccttttccaggtccttatccaggttatcctggtgctgcacctagccaacaatatccaggaccatttcctggccaacagtatccaggtttccctccaccaggccagggatacccaggtttccctgcaccaggccagggaaacccaggattccctgcacaagatccacaaaaacctggagctccagggcagcctgaatatcctgctccatctgctctagttcagctaaaagttccgtatgaacttcctctgccatctggggttgtacaccgtctagtgatcacaattcatggcacagttaacccaaatgcaaagagatttgccattgacttcagaagaggccatgatattgccatgcacatcaacccacgttttgatgaaagaccccatgttattgtgcgcaattcaatgatccataacaaatggggacatgaagagcgacatgctcaaaagtttccattcgtagcaggccagccttttaagctccaagtcatgtgtgaagctgaccattacaaagtggctataaacaacgaaactcttttccagtacgtccacagggtgaaggagctacatgaaatcaggagtgtgtgtattgctggtgatgttactttaaatgaggttactccttccatggcctgaggatttatgatttatgaaatttgtagagaactcctttgtaactggctcagccactatgccaagatgttaattcaaccaatgaacttttgttacagtaattaaattgtttgtggttcttactggaaaataaaatattgcattgtaatacaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MADDFSLEEALPSQSAANAQHSQGQEQGQPPQQPWQWGNPPPGQYPFPGPYPGYPGAAPSQQYPGPFPGQQYPGFPPPGQGYPGFPAPGQGNPGFPAQDPQKPGAPGQPEYPAPSALVQLKVPYELPLPSGVVHRLVITIHGTVNPNAKRFAIDFRRGHDIAMHINPRFDERPHVIVRNSMIHNKWGHEERHAQKFPFVAGQPFKLQVMCEADHYKVAINNETLFQYVHRVKELHEIRSVCIAGDVTLNEVTPSMA
Donor tissue: neurula