ORFeome > MGC75845 – XORFeome 2.0

MGC75845 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC75845, mRNA (cDNA clone MGC:75845 IMAGE:5382619), complete cds
Gene Symbol: MGC75845
Gene ID: 394652
ORF gb_acc: MG133044
ORF ID: 10445

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC061330

Library Location

Plate ID: GDExt11004
Well Location: H08

EST Sequences

Clone: MGC:75845 IMAGE:5382619
Trimmed Sequence: ATGGACAGAAGACTTTCCAACCCCCCGGTCCCCGGGGCCCCTGTGGATTTCTCCTTCAAATGCATCAACTCAGTGGAAGATGTGCTGCTGGAAGAGCCCAGGCTGGGGGTGAGGCCCCTCAAGCGCTGTGAGAATGGCAAGCTCCTGAGCCAAGCTCTGCGCCTCAACAACAACACCCTGACCGACCTCAAAGGCTTCGGGGAGACGGCAGAAAAGCTGCTGAGTGACCCCCCCCAACTCCGCTGGATTGACTTGTCCTTTAATGATCTGTCCACCATTGACTCTGTCCTGCCCAAATACCGAAACCTCAGCGTCCTCAATCTCCATAGCAACAGCATCAGGCAACTGTCCCAGGTGGATAAACTGGCCGCCTTGCCCAACCTGAAGAGCCTGACCCTGCACGGCAACCCAATCGAGGGAGAGCGAGGCTACAGGTGCTACATCCTCTCTGTGCTGCCGCAGCTGAAGACATTGGATTTCAGCGCTGTCACCAAGCAAGACCGTGTCACCGCCGACGTCTGGAGGCGCATGAACATGAAGCCGCGGCGCCTGAGAAGGAATAAAGATGAATAG
Full Trace Sequence: gacgagttgaaactgcggcgctttcctgctttgcgggactctggcgtctccggcagccgcagctacagatcgcagcgcgcacagacgcatcggggagacgcaatacagaggcgggcgcggccatagaaacccagcgatggacagaagactttccaaccccccggtccccggggcccctgtggatttctccttcaaatgcatcaactcagtggaagatgtgctgctggaagagcccaggctgggggtgaggcccctcaagcgctgtgagaatggcaagctcctgagccaagctctgcgcctcaacaacaacaccctgaccgacctcaaaggcttcggggagacggcagaaaagctgctgagtgaccccccccaactccgctggattgacttgtcctttaatgatctgtccaccattgactctgtcctgcccaaataccgaaacctcagcgtcctcaatctccatagcaacagcatcaggcaactgtcccaggtggataaactggccgccttgcccaacctgaagagcctgaccctgcacggcaacccaatcgagggagagcgaggctacaggtgctacatcctctctgtgctgccgcagctgaagacattggatttcagcgctgtcaccaagcaagaccgtgtcaccgccgacgtctggaggcgcatgaacatgaagccgcggcgcctgagaaggaataaagatgaataggcccagtgcgtctgtgccctcgccgcagggaaacgcttccgatctctggaacagccaatggcctttgtgccccccccctttactttctattgttcccaaagcttcttagcactgaggttctgatccacaaacaatatgttgagaagcaccagcaccggtagtgtaacacagtgagtaaggggggtaaatgcccctgtgccatcgggtttaaccctttatgtctatggccctgcccaacttctactgatccacaggggggaaatagaagtggccccaatacagaaccctgggggacccactaagtagagaatgtaccagtgacccccaccccctgtacccgaccctgtgccagttccctacccatgtgccaacatcgcttagaccgacagccctgagtttagaaaacagtaatatgtggggcgcggtatcaaacgctttggcacaaaatagatgccccctttttgggtcgggtttaacccccccttgtatcacctgggctgtaggacggctgatatctgagtagggaacgtcttgtctgtaaataaatattccttgagaatggaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MDRRLSNPPVPGAPVDFSFKCINSVEDVLLEEPRLGVRPLKRCENGKLLSQALRLNNNTLTDLKGFGETAEKLLSDPPQLRWIDLSFNDLSTIDSVLPKYRNLSVLNLHSNSIRQLSQVDKLAALPNLKSLTLHGNPIEGERGYRCYILSVLPQLKTLDFSAVTKQDRVTADVWRRMNMKPRRLRRNKDE
Donor tissue: neurula