ORFeome > MGC75851 – XORFeome 2.0

MGC75851 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC75851, mRNA (cDNA clone MGC:75851 IMAGE:5382709), complete cds
Gene Symbol: MGC75851
Gene ID: 394737
ORF gb_acc: MG133042
ORF ID: 10443

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC061333

Library Location

Plate ID: GDExt11004
Well Location: C07

EST Sequences

Clone: MGC:75851 IMAGE:5382709
Trimmed Sequence: ATGGAGCAGACTGAAGTGCTAAAGCCCAACACCCTGGATGAGCTGATCCAGATCCTGCATGAGATATTTGCCAGTGATAAAGTGAATATAGAGGAGGTGCAGGCTATAGTGGAGTCCTATGAAAGCAACCCAAGGGAATGGATGAAATTTGCCAAGTTTGACCAGTACAGGTACACCCGAAATCTTGTGGATGAGGGAAATGGAAAGTTCAATCTAATGATCCTGTGCTGGGGAGAAGGACATGGCAGCAGTATCCATGACCATGCCAACTCCCACTGCTTCTTGAAAATCCTTCAGGGAAGCCTCAAAGAAACTCTGTATGAGTGGCCCAAGAAAAAAAGTAACACTGAAATGGTGAAGAAGGCAGAAGGTGTATTGAAGCTGAATCAATGTGCCTATATTAATGATTCTATTGGCCTCCATCGTGTAGAGAACCCGAGCCATACAGAGCCTGCTGTAAGCCTCCATTTATACAGCCCTCCATTTAATGAGTGCCACACATTCGATCAGAGGACTGGACACACAAATTCAGTGAAAATGACTTTTTGGAGCAAGTATGGAGACAGAACTCCTTTTGCAATTGCACAGTCGCAGGAAAATAACTAA
Full Trace Sequence: gtgaagcttccctcacacagcagtagtgcaacatggagcagactgaagtgctaaagcccaacaccctggatgagctgatccagatcctgcatgagatatttgccagtgataaagtgaatatagaggaggtgcaggctatagtggagtcctatgaaagcaacccaagggaatggatgaaatttgccaagtttgaccagtacaggtacacccgaaatcttgtggatgagggaaatggaaagttcaatctaatgatcctgtgctggggagaaggacatggcagcagtatccatgaccatgccaactcccactgcttcttgaaaatccttcagggaagcctcaaagaaactctgtatgagtggcccaagaaaaaaagtaacactgaaatggtgaagaaggcagaaggtgtattgaagctgaatcaatgtgcctatattaatgattctattggcctccatcgtgtagagaacccgagccatacagagcctgctgtaagcctccatttatacagccctccatttaatgagtgccacacattcgatcagaggactggacacacaaattcagtgaaaatgactttttggagcaagtatggagacagaactccttttgcaattgcacagtcgcaggaaaataactaaaccggatccaaaaaaatgaataacctgagaaactggaaatattttagattcactcagtgctgatgtgaccaaactgtaactggacctcctgggaaacttttgaaaaaaaggcagaaactttcatccaatggcggcatttcttgagacctaaggaaatcaacattttaattccctgttttgaaataaattgtacagtaatgcaaattaagaaacatctgctttaaaactggaaatctggaatattctttaatttttgtaaagctgctttcctgtgaaacaatttctgctgaatagccttgaattttctagaataattgtatagtttttaatgtttgttgtaacaaatgtacattttctgatcttaatatttttagaagaactagcatatgaattggcttgctcatccgtgttattttaagtctcttttatgagtctgtttccttgtactgttgttcatgttaagtttgataagataagttatcattgttgtagtgacttataaggaaaacaatcctcctcctaccgtgattgagcaattcatttagcaactttgctttgatgtttcatgtgagcgtgtggcttttaaaacaataaaaatgtgttgactccagtaatcatacagatggtatattatctggaagcccagattggccctgaaacacagcattgctatttaatacttcacttttacttttttgtgtcaataataacaagacagtaccttgtacttgatgttaaataagccagcatggagcaatggcaccaataatcatagtagtttttaaagcataattctccatgcaagaggcattatctaacacccaaggcccaagcattccagttaatagatcctatacctgtcaaaaaaaaaaaattaaatgtactgtttaaatattataagctaatcactttttgtttgttcttttagatctacagaaaataattatgtaatgtaataaagcaagttttttaaaaaaaaaaaaaaaaaaaaaa
Translation: MEQTEVLKPNTLDELIQILHEIFASDKVNIEEVQAIVESYESNPREWMKFAKFDQYRYTRNLVDEGNGKFNLMILCWGEGHGSSIHDHANSHCFLKILQGSLKETLYEWPKKKSNTEMVKKAEGVLKLNQCAYINDSIGLHRVENPSHTEPAVSLHLYSPPFNECHTFDQRTGHTNSVKMTFWSKYGDRTPFAIAQSQENN
Donor tissue: neurula