ORFeome > MGC75889 – XORFeome 2.0

MGC75889 – XORFeome 2.0

General Information

Species: Xenopus tropicalis C6orf67-like protein, mRNA (cDNA clone MGC:75889 IMAGE:5383263), complete cds
Gene Symbol: MGC75889
Gene ID: 394738
ORF gb_acc: MG133015
ORF ID: 10403

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC061349

Library Location

Plate ID: GDExt11005
Well Location: C01

EST Sequences

Clone: MGC:75889 IMAGE:5383263
Trimmed Sequence: ATGGCGATGAATTATAATGCCAAGGAGGAAGATGGACATAATCACACGTCGGGTGTTGGTCCTAATTTAGGGAAGAGCAAAAAGCCTGATAATACGGCCTTCAAACAGCAGCGCCTCCCTGCCTGGCAGCCCATTCTCACAGCCGGTACCGTTCTACCAGCGTTCTTTATTATCGGGATCGTGTTTATTCCCATCGGGATCGGCATTTTTGTCACTTCCAATAACATCCGGGAATTCGAGATTGACTACACTGGAATAGATCCCAGCAGTCCTTGCTACAAGTGCTTAAATGTCACCTTGAATGACCCACCATGTACTTGCACTATTAATTTTACTTTAGATTATGCATTTGAGAGCAATGTTTTTATGTATTATGGACTATCAAACTTCTATCAGAATCATCGTCGATATGTCAAATCCAGAGATGATAGTCAACTAAATGGAGACAAAAATTCTCTTACAAACCCAAGTAAGGAGTGTGAGCCATACCGAACCAATGGAAGTAAGCCTATTGCTCCATGTGGTGCCATTGCCAACAGTATGTTTAATGACACACTCGTTCTGTATCAAATTGTGAATGGTGCAGAAAAACAGATTCCACTGGTCAAAAAAGGTATTGCTTGGTGGACAGATAAAAATGTGAAGTTCAAAAATCCCACTGGAAATGCAAGTAACCTAGAAGCTGTTTTTGCAGGTACAACAAAGCCAATTAACTGGAAAAAACCAGTTTATGAGCTAGATCCAAGTGAGCCTGATAACAATGGATTCATCAATGAAGATTTTATTGTATGGATGCGTACTGCTGCTTTGCCTACATTCAGAAAGCTTTATCGTTTGATAGAGAAGACTGATGCTACATATCCAACTCTGGCACCTGGCAATTACTCTCTTGTTGTTGAATACAATTACCCTGTTCGCAGCTTTGATGGAAGGAAGAGGATGATTCTCAGCACCATCTCCTGGATGGGAGGAAAAAATCCATTCTTGGGAATTGCTTACATTACCGTGGGATCAATATGCTTTTTCCTTGGTGTTGTACTGTTTGTTATACATCATAAATATGGAAACCGTAACAATAGCGCTGATATTCCCAACTAA
Full Trace Sequence: ggatagtttccgatggcgatgaattataatgccaaggaggaagatggacataatcacacgtcgggtgttggtcctaatttagggaagagcaaaaagcctgataatacggccttcaaacagcagcgcctccctgcctggcagcccattctcacagccggtaccgttctaccagcgttctttattatcgggatcgtgtttattcccatcgggatcggcatttttgtcacttccaataacatccgggaattcgagattgactacactggaatagatcccagcagtccttgctacaagtgcttaaatgtcaccttgaatgacccaccatgtacttgcactattaattttactttagattatgcatttgagagcaatgtttttatgtattatggactatcaaacttctatcagaatcatcgtcgatatgtcaaatccagagatgatagtcaactaaatggagacaaaaattctcttacaaacccaagtaaggagtgtgagccataccgaaccaatggaagtaagcctattgctccatgtggtgccattgccaacagtatgtttaatgacacactcgttctgtatcaaattgtgaatggtgcagaaaaacagattccactggtcaaaaaaggtattgcttggtggacagataaaaatgtgaagttcaaaaatcccactggaaatgcaagtaacctagaagctgtttttgcaggtacaacaaagccaattaactggaaaaaaccagtttatgagctagatccaagtgagcctgataacaatggattcatcaatgaagattttattgtatggatgcgtactgctgctttgcctacattcagaaagctttatcgtttgatagagaagactgatgctacatatccaactctggcacctggcaattactctcttgttgttgaatacaattaccctgttcgcagctttgatggaaggaagaggatgattctcagcaccatctcctggatgggaggaaaaaatccattcttgggaattgcttacattaccgtgggatcaatatgctttttccttggtgttgtactgtttgttatacatcataaatatggaaaccgtaacaatagcgctgatattcccaactaattgttgatacagtactacttgcatgtgcatctgggcaaattccacactgcacaaaaacatgtatgctatattccagctatagtatttttaatgagtgggcacaaattttaaggcctttttatttgttgtaatctgggagaaaactagtaaagtattgctgaaatatgaaatattgaaactaaacttgtactttgtttcaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAMNYNAKEEDGHNHTSGVGPNLGKSKKPDNTAFKQQRLPAWQPILTAGTVLPAFFIIGIVFIPIGIGIFVTSNNIREFEIDYTGIDPSSPCYKCLNVTLNDPPCTCTINFTLDYAFESNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDKNSLTNPSKECEPYRTNGSKPIAPCGAIANSMFNDTLVLYQIVNGAEKQIPLVKKGIAWWTDKNVKFKNPTGNASNLEAVFAGTTKPINWKKPVYELDPSEPDNNGFINEDFIVWMRTAALPTFRKLYRLIEKTDATYPTLAPGNYSLVVEYNYPVRSFDGRKRMILSTISWMGGKNPFLGIAYITVGSICFFLGVVLFVIHHKYGNRNNSADIPN
Donor tissue: neurula