ORFeome > MGC75957 – XORFeome 2.0

MGC75957 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC75957, mRNA (cDNA clone MGC:75957 IMAGE:5384032), complete cds
Gene Symbol: MGC75957
Gene ID: 395012
ORF gb_acc: MG133011
ORF ID: 10398

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC064720

Library Location

Plate ID: GDExt11004
Well Location: D09

EST Sequences

Clone: MGC:75957 IMAGE:5384032
Trimmed Sequence: ATGAACGTCTTTAGGCTGAGTGGGGACCTGTCCCACCTGGCAGCCATCATCATCCTGCTGCTGAAGATATGGAAGAGCCGGTCCTGTGCCGGTATATCTGGAAAGAGTCAGCTACTCTTTGCACTGGTGTTTACCACCCGGTACCTGGATCTCTTGACATCATTTATTTCATTGTACAACACATCTATGAAGGTAATCTATATCGGATGTGCATATGCAACAGTCTATCTGATATACATGAAATTCAAGGCTACATATGATGGGAACCATGACACTTTCCGAGTGGAGTTTCTTGTAGTCCCTGTTGGTGGATTATCAGTCCTGGTCAATCACGACTTTTCTCCTCTTGAGATCCTGTGGACATTTTCCATCTACCTGGAGTCTGTTGCAATCCTGCCTCAGTTGTTCATGATCAGTAAAACAGGAGAAGCAGAGACAATCACCACCCATTACCTGTTCTTCCTGGGCTTGTACCGTGCCTTGTACCTCTTCAACTGGATTTGGCGTTATTCTTTTGAGGGCTTCTTTGATCTGATTGCCATTGTGGCAGGTGTGGTGCAGACTATCCTTTATTGTGACTTCTTCTACTTGTATGTGACAAAAGTGCTTAAAGGAAAGAAACTAAGTTTGCCAGCGTAA
Full Trace Sequence: cagctctccggccagctgtcctctcctgtcccccggattcgcttaacctcattcccccagcgccaccccagcctcccctgcacaaatgaacgtctttaggctgagtggggacctgtcccacctggcagccatcatcatcctgctgctgaagatatggaagagccggtcctgtgccggtatatctggaaagagtcagctactctttgcactggtgtttaccacccggtacctggatctcttgacatcatttatttcattgtacaacacatctatgaaggtaatctatatcggatgtgcatatgcaacagtctatctgatatacatgaaattcaaggctacatatgatgggaaccatgacactttccgagtggagtttcttgtagtccctgttggtggattatcagtcctggtcaatcacgacttttctcctcttgagatcctgtggacattttccatctacctggagtctgttgcaatcctgcctcagttgttcatgatcagtaaaacaggagaagcagagacaatcaccacccattacctgttcttcctgggcttgtaccgtgccttgtacctcttcaactggatttggcgttattcttttgagggcttctttgatctgattgccattgtggcaggtgtggtgcagactatcctttattgtgacttcttctacttgtatgtgacaaaagtgcttaaaggaaagaaactaagtttgccagcgtaagtgccaaagattatgaccagcagctgtcccctccaccggctggacagaacaatccttacttcgtgtgaaggtgtaagatgcctgaagcagagtcagaaacactacttttatataccgaactgccctgtttgctgccggagaggcacagaagcaggtcccgggccagcccctccctcagcaaattcgccaagtcaacgacgactcgattaaacaacctgatttgttttatgcatcttgcctttcctggttttatattatgatgtataaagatttttttacataagaaacgtatgctgtaatgagaaatttcagtgcgcagtttcagttttaatagttgtaaaagtgagattttttttgtgcagtttacaactaggttcaagtgcaaaattctttcttcccctctctgttccgagctcattaaggggcgtttgagcccctttactggattgtatccatttaactccagtcattccactataatttattttgttttagacgatacatattctggttttgtgatgtttcaacaggttttttttttctacattctctatgggaggcgcatggggtgggaggggggattctttttttttttttttttaatttctttagttctttttaaagatacaaatattcaaaaaaggttttttttcttccaaataaatattgatcatgacgcattaacagtgatttgttgtgaggctctctggcagcagatggaatgcattgccattggtccaatacaaacctgtattttgatataccttcacatttcactaaaacaccaaaacggttccgtttttattaacacttcaaattcccgcacctggtgagtaatcaaggctgtggtagcataagggataacgtatgtgggccacacgagaaggtgaggtgatatttttttattcaaagtgttgtaaaaggaaaattgtactaaagtatctttcataaagaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MNVFRLSGDLSHLAAIIILLLKIWKSRSCAGISGKSQLLFALVFTTRYLDLLTSFISLYNTSMKVIYIGCAYATVYLIYMKFKATYDGNHDTFRVEFLVVPVGGLSVLVNHDFSPLEILWTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLFNWIWRYSFEGFFDLIAIVAGVVQTILYCDFFYLYVTKVLKGKKLSLPA
Donor tissue: neurula