ORFeome > MGC75973 – XORFeome 2.0

MGC75973 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC75973, mRNA (cDNA clone MGC:75973 IMAGE:5384246), complete cds
Gene Symbol: MGC75973
Gene ID: 394843
ORF gb_acc: MG133007
ORF ID: 10394

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC063367

Library Location

Plate ID: GDExt11004
Well Location: A06

EST Sequences

Clone: MGC:75973 IMAGE:5384246
Trimmed Sequence: ATGGCGGCGGCGTGCCTGGTGTTGCGGAGGTCGCTTGGTGGGGCAGTGCTGCAGGGGGGACGGGCGGCCTGGCCGGTGGCTCCTCAGGCCAACATGTCCTTCTCCACTCTGTCCCGGGGCAGGAAGGTGGCTCTCTCCACATTAGGTATTTTGGTCGCCGGAGGCTCCGGTTTGGCGTTTGCACTCCACCAATCAGTGAAAGCCAGTGAATTAGAGCTCCACCCACCCTCCTACCCATGGAGCCACAACGGACTCCTCTCCTCGTTGGATCACGCCAGCATCCGGCGCGGCTACCAGGTGTACAAACAGGTGTGCGCCGCCTGTCACAGTATGGAATACTTGGCCTTTAGGAACCTCATCGGCGTCTCCCACACGGAAGCAGAGGCCAAAGCGCTGGCGGAAGAGTTTGAGATTCTGGACGGCCCGGATGAGAATGGGGAGATGTTCACCCGGCCCGGGAAGCTGTCGGATTATTTCCCCAAGCCGTACCCCAATGACGAGGCGGCCAGAGCGTCCAACAATGGGGCGCTGCCCCCCGACCTCAGCTACATTGTCAATGCCAGGCACGGCGGGGAGGATTACGTTTTCTCTCTCCTGACTGGTTACTGCGACCCCCCCGCTGGCGTCAGTTTAAGAGAAGGACTGTATTACAACCCGTACTTCCCCGGCCAGGCCGTCGGGATGGCGCCCCCTATTTATAACGAGGTCCTGGAATTTGATGATGGGACCCCGGCCACCATGTCGCAGGTTGCTAAGGACGTCTGCACATTCCTGCGTTGGGCTTCAGAACCGGAACACGACCAGCGCAAGCGAATGGGCCTTAAAGTGCTGATGATCTCTTCCATCCTGATCCCACTCATCTACTACATGAAGAGACACCGATGGAGCGTGCTGAAGTCCAGGAAGATTGCCTACCGGCCCCCCAAGTAA
Full Trace Sequence: tgacagaggaagatggcggcggcgtgcctggtgttgcggaggtcgcttggtggggcagtgctgcaggggggacgggcggcctggccggtggctcctcaggccaacatgtccttctccactctgtcccggggcaggaaggtggctctctccacattaggtattttggtcgccggaggctccggtttggcgtttgcactccaccaatcagtgaaagccagtgaattagagctccacccaccctcctacccatggagccacaacggactcctctcctcgttggatcacgccagcatccggcgcggctaccaggtgtacaaacaggtgtgcgccgcctgtcacagtatggaatacttggcctttaggaacctcatcggcgtctcccacacggaagcagaggccaaagcgctggcggaagagtttgagattctggacggcccggatgagaatggggagatgttcacccggcccgggaagctgtcggattatttccccaagccgtaccccaatgacgaggcggccagagcgtccaacaatggggcgctgccccccgacctcagctacattgtcaatgccaggcacggcggggaggattacgttttctctctcctgactggttactgcgacccccccgctggcgtcagtttaagagaaggactgtattacaacccgtacttccccggccaggccgtcgggatggcgccccctatttataacgaggtcctggaatttgatgatgggaccccggccaccatgtcgcaggttgctaaggacgtctgcacattcctgcgttgggcttcagaaccggaacacgaccagcgcaagcgaatgggccttaaagtgctgatgatctcttccatcctgatcccactcatctactacatgaagagacaccgatggagcgtgctgaagtccaggaagattgcctaccggccccccaagtaacggcagccgacagctcagcaccgggaagcccctccccctgcgcgttggcctcagcagatgccatggatgatttgccaggcaacggtccctttgctcctccgagcaggaagtagatccggacacggctccgtaactcacaggcgctgcgtccgtatctttttgttttttttatgtttattttttgtctcgggggaattttttgttcctgcttctctgcgttttcactgtttttgtccggaaagaaccaaaccgaggaggaaaaagggactcgtgcgaagaaacgattgtgtccattacatcccattatgggctcgttaaattaaacaaaaatatatcttttaaaccaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAAACLVLRRSLGGAVLQGGRAAWPVAPQANMSFSTLSRGRKVALSTLGILVAGGSGLAFALHQSVKASELELHPPSYPWSHNGLLSSLDHASIRRGYQVYKQVCAACHSMEYLAFRNLIGVSHTEAEAKALAEEFEILDGPDENGEMFTRPGKLSDYFPKPYPNDEAARASNNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVSLREGLYYNPYFPGQAVGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWASEPEHDQRKRMGLKVLMISSILIPLIYYMKRHRWSVLKSRKIAYRPPK
Donor tissue: neurula