ORFeome > MGC76000 – XORFeome 2.0

MGC76000 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC76000, mRNA (cDNA clone MGC:76000 IMAGE:5384547), complete cds
Gene Symbol: MGC76000
Gene ID: 394531
ORF gb_acc: MG133528
ORF ID: 11054

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC061410

Library Location

Plate ID: GDExt11010
Well Location: G05

EST Sequences

Clone: MGC:76000 IMAGE:5384547
Trimmed Sequence: ATGCCTAGAGCTCCGCAGCGCCGCCCTACAGTTCTAAGCTCCATTCTCACCTTCAACAAAGAATTCCCCTTTGATGTTCAGCCCATTCCATTAAGGAGGATTTTAGCGCCCGGAGAAGAGGAAAATCTAGAAGTAGAGGAAGAGGAAGAAGATGGTGGGGCCGGAGTTGGGTCTCCTGATTTGTTTCCTGCCCGTGTCCCAGGTACGCTCCTACCCAGGCTGCCGTCTGAACCCGGGATGACGTTACTCACAATTAAAATTGAGAAGATTGGCTTGAAAGATGCAGGACAGTGCATTGATCCTTACATTACTGTTAGTGTAAAGGATCTAAACGGCATTGATTTGACTCCAGTACAAGACACCCCAATGGCCACGAGGAAAGAAGACACCTACGTCCATTTTAATGTCGAAATTGAAATCCAGAAACACGTGGAAAAGCTAACAAAAGGGGCAGCTATATTCTTTGAATTCAAGCACTACAAACCGAAGAAACGCTTCACCAGCACAAAGTGTTTTGCTTTCATGGAGATGGACGAGATCAAGTCGGGACAGCTCGTAATAGAACTCTACAAGAAACCCACTGACTTCAAAAGGAAGAAACTACAGTTGCTGACAAAGAAGCCGCTGTACCTGCATCTGCTGCAAACTCTGCAGAAGGACTGA
Full Trace Sequence: cacagtgcggctggcagcgcccgggaaacatgcggagctgagctgcccctcatccctttctgccccgggaggggcgtcagctcccagccatgactgacctgaacaagatcctgcacaaatggagcgccagcctcaagaagggcactgacttcgactcatgggggcagctggtggaggccattgatgagtaccagatattagcacggcagctccagaaggaagcccagtctccagccaactcctcagactttacagaggatcagaagaaaaccattgggaagattgcaacatgcctagagctccgcagcgccgccctacagttctaagctccattctcaccttcaacaaagaattcccctttgatgttcagcccattccattaaggaggattttagcgcccggagaagaggaaaatctagaagtagaggaagaggaagaagatggtggggccggagttgggtctcctgatttgtttcctgcccgtgtcccaggtacgctcctacccaggctgccgtctgaacccgggatgacgttactcacaattaaaattgagaagattggcttgaaagatgcaggacagtgcattgatccttacattactgttagtgtaaaggatctaaacggcattgatttgactccagtacaagacaccccaatggccacgaggaaagaagacacctacgtccattttaatgtcgaaattgaaatccagaaacacgtggaaaagctaacaaaaggggcagctatattctttgaattcaagcactacaaaccgaagaaacgcttcaccagcacaaagtgttttgctttcatggagatggacgagatcaagtcgggacagctcgtaatagaactctacaagaaacccactgacttcaaaaggaagaaactacagttgctgacaaagaagccgctgtacctgcatctgctgcaaactctgcagaaggactgagcgtgggcgtgtccctcccaggcccggccccctgcagtaccccggcacgcaggcagggggggggggcattccatcactggagtcacagagcaagagaaagccatcgggatatggaacgtttatctacattcacaaaactcatttttttaatagaaatatgttccccgaaagtatctatttttggcccaagggtcgaggccgcagcaataacagacttggggtgtagcaccttgtgtttctctgccgcccatgtacgtgccccgcggtgttaaaggacttggtgactggctcactcttgtacataggagtctaacacgtatgctgtgtgtgcatacagcgcaggcatgctacccggggggatccattatgtatttacccagaaccccagtgcatggaaccccccctgtattacatccttccaataaaaaccactgggattttttataagcagaatcctattttctacagatctaatttaaatcctttgtaatcggtgtaatgtgattatgatgccccgcccatcccgattccttggcacctgattggtcctgtactcattctaatgtatattttatatttaatcttctaccggcgcattcagtttactggtaaagctgaatgggcgggaaagtaatgatttcctatgtaattgattcccaacacataaaagcccctaattgccccagagtttgctgatacagtgtgggactgggtctcctagggccccccagagccaacgcttacagccattagagagacatataggcatattctcttgattggccgatctgacactgtgctgtattcttgtcacttcccattggctcatataggtgaccaatggcagtgctgtataatttgtaatccattgccacagctttccccaaatatggcaccctaagcaacgtgtgggtcaccttgaaagtgattggcagcagagcccacccctcattgtacctgaaatagtaccaccccccctagtgctacactacatcatccaatcaaagaggcagttgaactgtttttttttttctttttaatattgaaatattgtttggccccaggagagtgattgacaaggtggggcgctcagtagaacattgcaacaaactccacttccatgtaaactttgttaaaaataaatggttttgttagataaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MPRAPQRRPTVLSSILTFNKEFPFDVQPIPLRRILAPGEEENLEVEEEEEDGGAGVGSPDLFPARVPGTLLPRLPSEPGMTLLTIKIEKIGLKDAGQCIDPYITVSVKDLNGIDLTPVQDTPMATRKEDTYVHFNVEIEIQKHVEKLTKGAAIFFEFKHYKPKKRFTSTKCFAFMEMDEIKSGQLVIELYKKPTDFKRKKLQLLTKKPLYLHLLQTLQKD
Donor tissue: neurula