ORFeome > MGC76015 – XORFeome 2.0

MGC76015 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC76015, mRNA (cDNA clone MGC:76015 IMAGE:5384680), complete cds
Gene Symbol: MGC76015
Gene ID: 394565
ORF gb_acc: MG133479
ORF ID: 11002

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC061418

Library Location

Plate ID: GDExt11010
Well Location: D02

EST Sequences

Clone: MGC:76015 IMAGE:5384680
Trimmed Sequence: ATGTCCTTGCACCAGTTTTTACTTGAACCCATTAGCTGCCATGCCTGGAATAAGGATCTAACACAGATTGCAATTAGCCCAAATAACCACGAAGTTCATATCTACAAGAAGAGTGGAAATCAGTGGGTAAAAGGGCACGAGTTAAAGGAACACAACGGACACATCACTGGCATTGACTGGGCTCCTAAAAGCGATCGTATAGTAACATGTGGTGCTGACCGTAATGCATATGTTTGGAGCCAAAAGGATGGTGTATGGAAGCCAACATTGGTGATTCTACGCATTAACCGTGCAGCTACCTTTGTAAAGTGGTCTCCGCTAGAAAATAAGTTTGCAGTGGGAAGCGGAGCAAGACTCATATCTGTGTGCTACTTTGAATCTGAAAATGACTGGTGGGTAAGCAAACACATCAAGAAGCCTATCCGTTCAACTGTGCTGAGCCTGGACTGGCATCCCAACAATGTGTTACTGGCAGCTGGATCCTGTGACTTCAAGACAAGAGTGTTCTCTGCATATATTAAGGAAGTGGATGAAAAGCCTGCAAGCACTCCATGGGGATCCAAAATGCCTTTCGGTCAAATGATGTCAGAGTTTGGAGGAGTTAGCAGCGGAGGCTGGGTTCACAGTGTCAGTTTCTCAGCTAGTGGCAACAAACTTGCATGGGTCAGTCATGACAGTACTGTGTCAGTAGCTGATGCTTCTAAAAACATGAGTGTTTCCCAACTGAAGACGGAGTTTCTTCCTTTATTAAGCGTCATCTTTGTATCTGAAAACAGCTTGGTAGCTGCAACCCTGGAGTCATGTGTTCAAGGTCTCCGGATTATTTGA
Full Trace Sequence: tttgggattgtaagggaaagagcttgcaggcattctatcaataaccctcccttccaaagtcggtaggttactgacagcaggggaccagataatctaaactaactttttttaagaagttgaaccaacgtttccttctctgtcagggataagtaaagcatacaatttcatccatacgctccagttttcttttgggcaaaaaggaagatcacaatgtccttgcaccagtttttacttgaacccattagctgccatgcctggaataaggatctaacacagattgcaattagcccaaataaccacgaagttcatatctacaagaagagtggaaatcagtgggtaaaagggcacgagttaaaggaacacaacggacacatcactggcattgactgggctcctaaaagcgatcgtatagtaacatgtggtgctgaccgtaatgcatatgtttggagccaaaaggatggtgtatggaagccaacattggtgattctacgcattaaccgtgcagctacctttgtaaagtggtctccgctagaaaataagtttgcagtgggaagcggagcaagactcatatctgtgtgctactttgaatctgaaaatgactggtgggtaagcaaacacatcaagaagcctatccgttcaactgtgctgagcctggactggcatcccaacaatgtgttactggcagctggatcctgtgacttcaagacaagagtgttctctgcatatattaaggaagtggatgaaaagcctgcaagcactccatggggatccaaaatgcctttcggtcaaatgatgtcagagtttggaggagttagcagcggaggctgggttcacagtgtcagtttctcagctagtggcaacaaacttgcatgggtcagtcatgacagtactgtgtcagtagctgatgcttctaaaaacatgagtgtttcccaactgaagacggagtttcttcctttattaagcgtcatctttgtatctgaaaacagcttggtagctgcaaccctggagtcatgtgttcaaggtctccggattatttgataagtaaaattgcctttcctagcaggacaaaagacctcgtgggacccaatgcactgatcaaacataacaaccagctgccaacagaaatccttcaatgtccagctggccccatgagcattggaagaaactcagtaatattgatatggctacgtaaagatggaggctgtatgacattatgtttggaactgtttatattgttttcagctccaaatacaactgggatgtttgggtttctgactaaaatacgtggtggttaatctgtggtgaaaatcagtgaaattagttgcacttttttgtttttaattttttcttcatttaattgcataatttatcaacgctcgtcttagtagattctgtggggtgcacctgttactaagttaaaaggtgaattttatgtaaattgtctgctaggaaataaaaaagcaaaacattaaaaataaaaaaaaaaaaaaaaaaaaaa
Translation: MSLHQFLLEPISCHAWNKDLTQIAISPNNHEVHIYKKSGNQWVKGHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGVWKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFESENDWWVSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKTRVFSAYIKEVDEKPASTPWGSKMPFGQMMSEFGGVSSGGWVHSVSFSASGNKLAWVSHDSTVSVADASKNMSVSQLKTEFLPLLSVIFVSENSLVAATLESCVQGLRII
Donor tissue: neurula