ORFeome > MGC76058 – XORFeome 2.0

MGC76058 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC76058, mRNA (cDNA clone MGC:76058 IMAGE:5307463), complete cds
Gene Symbol: MGC76058
Gene ID: 395035
ORF gb_acc: MG132713
ORF ID: 10006

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064862

Library Location

Plate ID: GDExt11001
Well Location: E09

EST Sequences

Clone: MGC:76058 IMAGE:5307463
Trimmed Sequence: ATGTTTGCTAAGAATTTTAGGGTTAAGTCAAATACAGCTATAAAGGGATCGGACAGGAGGAAGCTGCGAGCAGATATCAGTTCTGCATTTCCTTTTCTTACCACAGAAAACTTGTCTGAGTTGATGCCATCTAAAGAGGAACTGAGTATTGTAAAAGTCTTTGCTCACAAAGGAGATGCAGTGACATTATACGTCCACAATCGAAACCCAGTTATGTTTGAACTGGAGAAAAACCTTTATCCAACAGTATATGCTTTGTGGAAGTATCCAGATCTTCTCCCAGCATTCACCACATGGCCACCTGTCCTGGAGAAAATGGCAGGTGGAGCAGATCTGATGCTGCCTGGTGTTGTTGTCCCCTCATTTGGTCTTCCTGAGATACAACAAGGCAGCCTATGTGCAATCACCTTGGTGGGAAACAGGGCACCTGTAGCGGTTGGTGTGGCCACTATGTCATCGAAAGAGATGCTGGCATCAGGAATGAAAGGGAAAGGTTTCAATATTTTGCACACATTTGGAGATCAGTTATGGGCATATGGAGACAAGTCTTGTTTGCCAAATATCCCCATACCGGAGGTCAGTCTAACAGTAGTGGAAGAAGGAGATGGGCAAGCTGTGTCCCAGGAGGTCTCCTCCGAAGCCCAGGATCCACAAGCACAGCTGGAGAATCTCAATCTCATGGAGGAAGAAACCACACACAAAGAAGAGGATTCTGAAAAACATTGTGAGGGTGTAGATGAACAGATTAAAGAGACAGAAAATTTAGTTCCTTTACAGAAGTCGTCTCAAGAAGCTATGGACAGTTTGCTGCACCAGTGCTTCTTTCATGCATTGAAGCATAAAGTGAAAAAATCCGATCTTCCTCTTCTTACAAGCACATTTCTGCGCAATTATCTTTTTGCCTGCTGTCCAGAAGGACAGCAAGTGGATATTAAAAAATCAAGTTACAAAAAGCTAACTAAGTTTTTACAAACTATGCAACAGCGAAAGGTTTTGCAGGTGAAGGAGCTCAATAAGGGAGTTGAGAGCATAGTGGAAATAGACTGGAAGCATCCTGATGTTCGTTCCTTTGTTGCACCAGAGCCTGTACCAGTGGACTTGGTAGTTTCTGGTAGCATAGATGGGGGTGGAGAATCGCCATACCAGCCCCCTGAAATAATAACCCTCTATGGTATTTCCAGTAAAATGCTGCCTCTTTTCCAAGAGGCAGGGCATAGAAAAGGAGATCTGCTCACCCATAGTGATGTTAGAAGCATCATTATTACTTATGTGAAAAACAATGAGCTTGTTGATTCAAATAATAAGAACTTTGTGAATATAAACCCAGTTCTGTGTGATTGCCTGCTTGAAAAATCAGAGCAGAATGACTTTTTCAGTCTGAAATGGGATGACCTTCTCTTAAGGTGTCTAGAGAAGATGCAGCATTCCCACCAAGTGACCTTCCCTGGACGACCACCTATTATACGAAAAGGAAACATTGATCCCATTGATATCAGTGTGGTGCAGAGGGCGTCAAACAAAAAGGTGACAATGATTAAAAATCTTGAATTGTATGGACTAGATCCCTCTTCAGTTGGGAGCATGCTCCAACAGCGTGTTCAAGCCAGTTCCACATGCACTGCCATTCCAGGGTCTAAGGACAGAGTGCAGGTGCAGATACAGGGCAACCAGGTGTCTCAGGTTGGAAAACTACTACTTGAAGAGTTTAAAATACCCCGCAAATACATTTCTGGATTGGACCTGGCTAAATCTGGTAAAAAGAAATGA
Full Trace Sequence: aattcatgctgcttatcacaggtttttgttttctgttttgcagaatatccctttattttattgcgataagggtttatccacagccatgtttgctaagaattttagggttaagtcaaatacagctataaagggatcggacaggaggaagctgcgagcagatatcagttctgcatttccttttcttaccacagaaaacttgtctgagttgatgccatctaaagaggaactgagtattgtaaaagtctttgctcacaaaggagatgcagtgacattatacgtccacaatcgaaacccagttatgtttgaactggagaaaaacctttatccaacagtatatgctttgtggaagtatccagatcttctcccagcattcaccacatggccacctgtcctggagaaaatggcaggtggagcagatctgatgctgcctggtgttgttgtcccctcatttggtcttcctgagatacaacaaggcagcctatgtgcaatcaccttggtgggaaacagggcacctgtagcggttggtgtggccactatgtcatcgaaagagatgctggcatcaggaatgaaagggaaaggtttcaatattttgcacacatttggagatcagttatgggcatatggagacaagtcttgtttgccaaatatccccataccggaggtcagtctaacagtagtggaagaaggagatgggcaagctgtgtcccaggaggtctcctccgaagcccaggatccacaagcacagctggagaatctcaatctcatggaggaagaaaccacacacaaagaagaggattctgaaaaacattgtgagggtgtagatgaacagattaaagagacagaaaatttagttcctttacagaagtcgtctcaagaagctatggacagtttgctgcaccagtgcttctttcatgcattgaagcataaagtgaaaaaatccgatcttcctcttcttacaagcacatttctgcgcaattatctttttgcctgctgtccagaaggacagcaagtggatattaaaaaatcaagttacaaaaagctaactaagtttttacaaactatgcaacagcgaaaggttttgcaggtgaaggagctcaataagggagttgagagcatagtggaaatagactggaagcatcctgatgttcgttcctttgttgcaccagagcctgtaccagtggacttggtagtttctggtagcatagatgggggtggagaatcgccataccagccccctgaaataataaccctctatggtatttccagtaaaatgctgcctcttttccaagaggcagggcatagaaaaggagatctgctcacccatagtgatgttagaagcatcattattacttatgtgaaaaacaatgagcttgttgattcaaataataagaactttgtgaatataaacccagttctgtgtgattgcctgcttgaaaaatcagagcagaatgactttttcagtctgaaatgggatgaccttctcttaaggtgtctagagaagatgcagcattcccaccaagtgaccttccctggacgaccacctattatacgaaaaggaaacattgatcccattgatatcagtgtggtgcagagggcgtcaaacaaaaaggtgacaatgattaaaaatcttgaattgtatggactagatccctcttcagttgggagcatgctccaacagcgtgttcaagccagttccacatgcactgccattccagggtctaaggacagagtgcaggtgcagatacagggcaaccaggtgtctcaggttggaaaactactacttgaagagtttaaaataccccgcaaatacatttctggattggacctggctaaatctggtaaaaagaaatgaagaagttgatcattcagtatgtggtgttagcggcccaacatgaaacactccaacttttaattggccaactagacctatgacaagaactggtattgggtaatcctttatgtcattcattatgggtttaacctctcagcggatgatcagtgctgtcatttactcagagtctacatcttcagctctgagaaaattcatctgttcagaaaacagcatgttcattaaactatgttcaaaataaaaaaaaaaaaaaaaaaaaa
Translation: MFAKNFRVKSNTAIKGSDRRKLRADISSAFPFLTTENLSELMPSKEELSIVKVFAHKGDAVTLYVHNRNPVMFELEKNLYPTVYALWKYPDLLPAFTTWPPVLEKMAGGADLMLPGVVVPSFGLPEIQQGSLCAITLVGNRAPVAVGVATMSSKEMLASGMKGKGFNILHTFGDQLWAYGDKSCLPNIPIPEVSLTVVEEGDGQAVSQEVSSEAQDPQAQLENLNLMEEETTHKEEDSEKHCEGVDEQIKETENLVPLQKSSQEAMDSLLHQCFFHALKHKVKKSDLPLLTSTFLRNYLFACCPEGQQVDIKKSSYKKLTKFLQTMQQRKVLQVKELNKGVESIVEIDWKHPDVRSFVAPEPVPVDLVVSGSIDGGGESPYQPPEIITLYGISSKMLPLFQEAGHRKGDLLTHSDVRSIIITYVKNNELVDSNNKNFVNINPVLCDCLLEKSEQNDFFSLKWDDLLLRCLEKMQHSHQVTFPGRPPIIRKGNIDPIDISVVQRASNKKVTMIKNLELYGLDPSSVGSMLQQRVQASSTCTAIPGSKDRVQVQIQGNQVSQVGKLLLEEFKIPRKYISGLDLAKSGKKK
Donor tissue: gastrula