ORFeome > MGC76067 – XORFeome 2.0

MGC76067 – XORFeome 2.0

General Information

Species: Xenopus tropicalis DAZ associated protein 2, mRNA (cDNA clone MGC:76067 IMAGE:5307607), complete cds
Gene Symbol: MGC76067
Gene ID: 394961
ORF gb_acc: MG132731
ORF ID: 10030

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064192

Library Location

Plate ID: GDExt11001
Well Location: G09

EST Sequences

Clone: MGC:76067 IMAGE:5307607
Trimmed Sequence: ATGAATAATAAAGGACAGTACCCTGCTGCCCCAGCCTACCCATCCCAGACTCCAAATCCTCAGTCAGTGTACCCACCAACCATGCATCTGCCACAGGCTCCTCCTTATACAGATGCACCTCCAGCTTATTCTGAGCTCTACCGATCTGGGTATGTGCATCAAGCAGCAGCTAATATGGCCCCTCTGTCTGCAGCTTACCCCCCCAGCACATCAATGTATCTTCCTATGGCTCAGGCTATGCAAGTTGCACCAATGGCCTCATCAGTACCTATGGCTTATTACCCTATTGGTCCTGTGTACCCACCTGGCTCCACAGTCATTGTTGAAGGGGGCTATGATGCAGGCGCTAGATTTGGTGTTGGTAGCTCCCCATCTGTTCCACCACCTCCACCGGGCTGCCCCCCGAATGCGGCTCAGCTGGCTGCCATGCAGGGTGCAAATGTATTGGTCACACAGAGGAAAGGCAATTACTTCATGGGTGGCTCAGATGGTGGCTACACCATTTGGTGA
Full Trace Sequence: aaaatacagatcgagcaagagacgtgaacccggggcaatgaataataaaggacagtaccctgctgccccagcctacccatcccagactccaaatcctcagtcagtgtacccaccaaccatgcatctgccacaggctcctccttatacagatgcacctccagcttattctgagctctaccgatctgggtatgtgcatcaagcagcagctaatatggcccctctgtctgcagcttacccccccagcacatcaatgtatcttcctatggctcaggctatgcaagttgcaccaatggcctcatcagtacctatggcttattaccctattggtcctgtgtacccacctggctccacagtcattgttgaagggggctatgatgcaggcgctagatttggtgttggtagctccccatctgttccaccacctccaccgggctgccccccgaatgcggctcagctggctgccatgcagggtgcaaatgtattggtcacacagaggaaaggcaattacttcatgggtggctcagatggtggctacaccatttggtgagatggaaccagaggcatgaaaacaggggttaaaaagcaaaaataaaacaaaaaaaaataaacataatacaatgggctagcctttgtacaaggaatggcatctcaccctgtgagcacttcccacaatgttctgctttagaatattaacccagatttgctgtttagtcacggatgtcgtgggatgtcttcctggtgctcattctttaagtactcctactatatattaaaggaggtccttttaataaggaaagaaaatgctttgcaaccctttaaaacacctctaacctcttcccatgcaccttcacttaataataaactttcaaattacaggctgattttaggctcaccgagtcctttagatgagggatggaaggactgtgcgttaggagtaatatttgaaataactgagaaattgttgtgctttataactgttgctggctttggaataggacacagctgtattaataacacctaggactgcatattgtatcttttaaagaaagcaaaatgaaatgcctagacagacaaatatatttggcctctattgctgaatgtcctatcatcatttctctatgtatttcagaaagtcctatttcttttcaatccccagatttcagatatatgcatcttgtttctgtcttctgcaagtcaaccatttgttttttaatttctgaatgctgcttgaaacaatttctgcttttcagggttatttgcccttttaattagcagcatgatagaatagttggatattgtagagattagcagttagactacacacgagggtgctatattatcattttcagatgcaaatcatataacttacaatacttaataatactatatatttttttttgttaaaatgattttaggtttaactactggtgtttctcaagtagcactgggaaatggaagtaataggcaaggctgctaagcatggtgctttttgtgccttttccaccaaatagcgtatataataagccagcctaaacacattttctgctcacctcttaaatctaaattatttgttcttctaaagggatggtgttttggtcaaggaatggtaattcagcaacactttattttttaagtaatttgccaacctacataaatgtataatgcatacttttatgaaaagaatgaacatgtatatatgtttttggaggtcagacttaagaaccactgacagcttaacaagtgcaaagagttatgaggcctgacatgcttctttacagtgtaaaagacaagagttagacttgtgggtgtagtaatgcatttttgaaatggaatatgattaaagatccttttgataccctgacaaaaaaaaaaaaaa
Translation: MNNKGQYPAAPAYPSQTPNPQSVYPPTMHLPQAPPYTDAPPAYSELYRSGYVHQAAANMAPLSAAYPPSTSMYLPMAQAMQVAPMASSVPMAYYPIGPVYPPGSTVIVEGGYDAGARFGVGSSPSVPPPPPGCPPNAAQLAAMQGANVLVTQRKGNYFMGGSDGGYTIW
Donor tissue: gastrula