ORFeome > MGC76074 – XORFeome 2.0

MGC76074 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC76074, mRNA (cDNA clone MGC:76074 IMAGE:5307708), complete cds
Gene Symbol: MGC76074
Gene ID: 394688
ORF gb_acc: MG132733
ORF ID: 10032

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC062501

Library Location

Plate ID: GDExt11001
Well Location: G11

EST Sequences

Clone: MGC:76074 IMAGE:5307708
Trimmed Sequence: ATGGCTGGCGTGGGCCGGGTGTTTTGCTCCTTATGGAGAAAATGTGGGGTGCACGAGTTTCGGGTGCCTTGTGCTTCTTATCATAAGAAGGTAGTTGATCATTATGAAAATCCAAGAAATGTTGGATCCCTTGACAAGAACGCAAAGAATGTTGGGACTGGGTTGGTGGGAGCACCAGCATGTGGTGATGTCATGAAACTACAGATTGAAGTGGACAACAATGGAAAGATTATTGAAGCCAAGTTCAAAACGTTTGGTTGTGGGTCTGCCATTGCCTCCAGTTCTCTTGCCACAGAATGGGTTAAGGGAAAAACGGTTGATGAAGCTATGACTATCAAGAATACAGACATAGCCAAAGAACTCTGCCTTCCACCAGTGAAGCTGCACTGTTCCATGCTGGCTGAAGATGCCATCAGAGCAGCCCTGGCAGATTACAGACTGAAGCAGGATAAAGACGAAGCTGCAGCAAGTGGCTAG
Full Trace Sequence: atttgctagctgcgcgagtggaggacgctatggctggcgtgggccgggtgttttgctccttatggagaaaatgtggggtgcacgagtttcgggtgccttgtgcttcttatcataagaaggtagttgatcattatgaaaatccaagaaatgttggatcccttgacaagaacgcaaagaatgttgggactgggttggtgggagcaccagcatgtggtgatgtcatgaaactacagattgaagtggacaacaatggaaagattattgaagccaagttcaaaacgtttggttgtgggtctgccattgcctccagttctcttgccacagaatgggttaagggaaaaacggttgatgaagctatgactatcaagaatacagacatagccaaagaactctgccttccaccagtgaagctgcactgttccatgctggctgaagatgccatcagagcagccctggcagattacagactgaagcaggataaagacgaagctgcagcaagtggctagctgagcagagtgtgagctctactataatggcaacatttagtcactttatgctgttcttttgggtattaaagcatgtctttaccatttgaatggcagacttctgatacgcacaattatttagcagcttgtcaaactgtgtgaatctcctcctaataatgtgattattttcaatttgcaagctgagtatacttagagtgtataaacaaaactattttgttctttattccctaatgtccaagacctccacctatcctctgttcacatgtaatttctggtttaaacacatggcactacattacagtgccaggtttgtcataccttccacgtaaagtaatatagaaatttcatctagtcatctagtttttgtttaagtattattgggaaatgccacaacgcacatcttcagatgcacaacgattgtgaggatgtgtggtttttccccgtctgtttccagcacccttatgtttgagttcttgataagtcttgtacggttttgtatataaatggctatgcattcataatacaatataaaacccatgctgaattacaagaatcaaacaaacgttgccactgtgttctgatccaatttgtgtggctcttactgaactgaaatgcaattgttctcagaaaggttcatttttgaaaattaaatgtctgactggaagcccctgatcccctccttctgttaccaagactgggtttgctaagccatatcctgccagagaaaagtacattgagttaattacattgggcctttaatagggagtggcatgttccaggtatcataccagcagccctgaaaattccccattttgagtactcagaatgatactggtagaatcgaaagcagggattatatgatgcttcttagttttgtatgcagtgcatttgaccagctgccttttgcttttgtatatatttggtaaaagataataaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAGVGRVFCSLWRKCGVHEFRVPCASYHKKVVDHYENPRNVGSLDKNAKNVGTGLVGAPACGDVMKLQIEVDNNGKIIEAKFKTFGCGSAIASSSLATEWVKGKTVDEAMTIKNTDIAKELCLPPVKLHCSMLAEDAIRAALADYRLKQDKDEAAASG
Donor tissue: gastrula