ORFeome > MGC76089 – XORFeome 2.0

MGC76089 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC76089, mRNA (cDNA clone MGC:76089 IMAGE:5308183), complete cds
Gene Symbol: MGC76089
Gene ID: 395001
ORF gb_acc: MG132759
ORF ID: 10063

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064201

Library Location

Plate ID: GDExt11001
Well Location: C07

EST Sequences

Clone: MGC:76089 IMAGE:5308183
Trimmed Sequence: ATGGGCAGCAAGAGAGCACTGCACTATGTCCTGAAAGTTGGGAACAGAGGCCAGACTGCCAGGTTTTACAGAGAGTTGCTGGGAATGAAAGTACTAAGGCATGAAGAATTTGAAGAAGGCTGTAAAGCTACTTGCAATGGTCCTTATGATGGGAAATGGAGCAAAACCATGATAGGCTATGGATCTGAGGACAGCCATTTTGTCGTTGAACTAACGTACAACTATGGAGTTGGACAGTATCGCGTAGGCAATGATTTTCTGGGCATAACTATTCAGTCAAGCCAGGCTGTGCAACATGCACGCCAGATGAAATGGCTGCTTGCTGAATTGCCAGGTGGATTATTTGAAGTGGTAGCCCCTGGAGGATATACATTTTATTTGGAAGACAAAGATCAGCCAAAAACAGACCCAGTGCGAAGGGTAGCACTTGCTGTCTCTGACCTGCAGAAATCTTTACACTACTGGTCCAGTCTATTGGGAATGAAAATTTACAGTAAGGATGAAACCAAGAAGAATGCCCTTTTGGGATATGGAGATAACCAGTGTAAGTTGGAACTACAGGATATTGGTGGGCCAGTGGACCATGGGACAGCGTTTGGCAGAATTGCCTTTGCTTGCCCTAAAGATGAGCTTCCAAACATCGAGGCAAAGATGAAAAAAGAAAATCAAAAAATTTTGACTCCTCTAGTAAGCCTGGACACACCTGGAAAAGCCACTGTTCAAGTTGTAATTTTGGCTGATCCTGATGGCCATGAAATTTGTTTTGTTGGTGATGAAGCATTTCAAGAACTGTCTCAGACCGATCCAACTGCAGACAAACTTCTTAATGATGCTATGGACGCAGACAAGAGTGCAGAATGGTTTGCAAAACACAGTAGACAGAAGCCTTCTGCCTAG
Full Trace Sequence: ctcaggaagaaagatgggcagcaagagagcactgcactatgtcctgaaagttgggaacagaggccagactgccaggttttacagagagttgctgggaatgaaagtactaaggcatgaagaatttgaagaaggctgtaaagctacttgcaatggtccttatgatgggaaatggagcaaaaccatgataggctatggatctgaggacagccattttgtcgttgaactaacgtacaactatggagttggacagtatcgcgtaggcaatgattttctgggcataactattcagtcaagccaggctgtgcaacatgcacgccagatgaaatggctgcttgctgaattgccaggtggattatttgaagtggtagcccctggaggatatacattttatttggaagacaaagatcagccaaaaacagacccagtgcgaagggtagcacttgctgtctctgacctgcagaaatctttacactactggtccagtctattgggaatgaaaatttacagtaaggatgaaaccaagaagaatgcccttttgggatatggagataaccagtgtaagttggaactacaggatattggtgggccagtggaccatgggacagcgtttggcagaattgcctttgcttgccctaaagatgagcttccaaacatcgaggcaaagatgaaaaaagaaaatcaaaaaattttgactcctctagtaagcctggacacacctggaaaagccactgttcaagttgtaattttggctgatcctgatggccatgaaatttgttttgttggtgatgaagcatttcaagaactgtctcagaccgatccaactgcagacaaacttcttaatgatgctatggacgcagacaagagtgcagaatggtttgcaaaacacagtagacagaagccttctgcctaggtgaacgtgacatattttataccgcctgaacattacaataataagcttcagtgcagaatggaagaacttggcctaattcagctacacaaatggaacatggtggccgtctcatgattctaatgcgtgaaatctatccttacaaaactttggttttgaatttattatatgaattagttatgaatttgtggcaaagtccaaaaaatgggcacaaatgttttttggggttttttttgcatttttgcaaaattcaatcttctgtttgaacactgaggtgcaactggagtagtgtacaaaaaaaaaatatttctctgtgctgcctgtgtttggctgagaggttagcagaaatgtttgtgtttagcaggaagggtggcttgtggccctcctggaacacctttagcttgcctactagcagaaaagtgcttggagctgctatgtactatggagggctgcactaaccatattaagtacagggctcatttgtgcatgacagccctgtaaagagcccgcttaagagcaaggctggaaggagaccatgatgtgtctcatcaggtcattccaaatcataatgtaaaatataaaaagcattgtatacagtatatgttgtgattcagagcattatttgggaagcatgattcagtacatggtcacatcatccaaaatattttttaagagatgaacaacacgctacaatttcaccttgtgcttagtcattataagattataattaaaaattgacacctacagaaaaactagacctgacgtcagaataaggacctgagctatctaaatccgcctctgcttgtttggtactacaactccctgtattcttaaggtaaagattgccatttgtcactataacagaaaaccaattatatgtcatttttataatctcctgccttcatcataatctgcagttgcttacagtgtttgtatttgacagtgatgttaaaaattgctagtgagtgtataaacttggtaccattgtttaaacaaataaaagtttaaataaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MGSKRALHYVLKVGNRGQTARFYRELLGMKVLRHEEFEEGCKATCNGPYDGKWSKTMIGYGSEDSHFVVELTYNYGVGQYRVGNDFLGITIQSSQAVQHARQMKWLLAELPGGLFEVVAPGGYTFYLEDKDQPKTDPVRRVALAVSDLQKSLHYWSSLLGMKIYSKDETKKNALLGYGDNQCKLELQDIGGPVDHGTAFGRIAFACPKDELPNIEAKMKKENQKILTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFQELSQTDPTADKLLNDAMDADKSAEWFAKHSRQKPSA
Donor tissue: gastrula