ORFeome > MGC76115 – XORFeome 2.0

MGC76115 – XORFeome 2.0

General Information

Species: Xenopus tropicalis translocase of inner mitochondrial membrane 10 homolog (yeast), mRNA (cDNA clone MGC:76115 IMAGE:5308807), complete cds
Gene Symbol: MGC76115
Gene ID: 394912
ORF gb_acc: MG132729
ORF ID: 10028

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064213

Library Location

Plate ID: GDExt11001
Well Location: G07

EST Sequences

Clone: MGC:76115 IMAGE:5308807
Trimmed Sequence: ATGGATCCTTTAAAAGCACAGCAGTTGGCAGCAGAGTTGGAGGTGGAAATGATGGCTGATATGTATAACAGGATGACTGGCGCGTGTCATAAAAAATGTGTTCCTCCACACTACAAAGAGGCCGAGCTGTCTAAAGGGGAAAGTGTATGCCTGGATCGCTGTGTTTCTAAGTATCTGGACATCCATGAGCGAATGGGAAAGAAGCTTACTGAGCTGTCTCTGCAAGATGAGGAGCTTATGAGGAAGATGCAACAGGGTGTGAGTTCGACATAG
Full Trace Sequence: cgcttagcggctttgccctcgcttcttgtctctccatagtgccgatctctgcagcagcgcctctgtacacgggtatcggcaagcgcctcattttcattcagagtaaaacagattatttgtctggaaatggatcctttaaaagcacagcagttggcagcagagttggaggtggaaatgatggctgatatgtataacaggatgactggcgcgtgtcataaaaaatgtgttcctccacactacaaagaggccgagctgtctaaaggggaaagtgtatgcctggatcgctgtgtttctaagtatctggacatccatgagcgaatgggaaagaagcttactgagctgtctctgcaagatgaggagcttatgaggaagatgcaacagggtgtgagttcgacatagtaacactgccaaaacaaaataaagaagtttatgttctgtataaccatatttttatggtgaaaaaacacacttttttatttgcaatggactattctacagataagtatgtgaaaacagatctgaaggaaagttttcctaactgctggactttttatttcctttttcaaaacggctaagaacagttttttttcacaaacactggaggagatgaatcttggcaaactgcattacccttcagttttcattttttgtcagaagggctgaattattgaaacagttttatggggtggttagtagtgaaatgtcagtgatattagtatctagcttgtttgaaataaccatgcaatatttaccaaacagtgctaaagagagcagtgtttgatattatgttgcacacatctttcttagaaaggacaaagcaacaatcctttacctccaatggacattagccagtgtgcatcctccttacacagccattcaacagaagtttgtttctaacaaactggtatctttctaatatttttttttttttgtgcctgctggtttctaagaatgccaatccagcagggatcagatatttctccttggctaatgcagatttgactgcaattaactggtgcaaaatgttcttttcctctgtcgccaatttagtcctttctcattttgtgaaccagcaatttatcacttttttttgttttttttttgtatcaaagtgcctaagttaataagaatgtggtttgtgatgcaaggcctccgagtaggtttttgcgtgtacgtcatgtaaatataaaatcatgttcaaaatgcagaaggcagaacggatagatagcgtcactgaacggtaaaacactactagctggtgagttgtgcagtgaaccgttgtcgttcattgttagtcttccagaaggaaagtgtttgatttcctcttcattaaattggtaaacttgtggtgggtttgttcctaacatattttgattttcgtttactttattaaagatgatccccgagaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MDPLKAQQLAAELEVEMMADMYNRMTGACHKKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSLQDEELMRKMQQGVSST
Donor tissue: gastrula