ORFeome > MGC76121 – XORFeome 2.0

MGC76121 – XORFeome 2.0

General Information

Species: Xenopus tropicalis UPF0608 protein C19orf42 homolog, mRNA (cDNA clone MGC:76121 IMAGE:5308990), complete cds
Gene Symbol: MGC76121
Gene ID: 394942
ORF gb_acc: MG132744
ORF ID: 10047

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064217

Library Location

Plate ID: GDExt11001
Well Location: E03

EST Sequences

Clone: MGC:76121 IMAGE:5308990
Trimmed Sequence: ATGATCGGAGATTTACTTCTATTCGGGACATTGCTGGTGAATGCTGGCGCTGTATTAAATTTCAAACTGAAGAAAAAGGAATCCCAGGGTTTTGGAGATGATTTGATGACAGAGGCCACTACAGGTGACAACATCAGGGAATTTTTACTCAGTTTGCGATACTTTCGAATTTTCATAGCACTGTGGAACATTTTCATGATGTTTTGTATGATTGTGTTATTTGGATCATGA
Full Trace Sequence: gtctttccagtcaccggaagtcggaagcactgaaacagctgatgaggtggcggagagtgcatcatgatcggagatttacttctattcgggacattgctggtgaatgctggcgctgtattaaatttcaaactgaagaaaaaggaatcccagggttttggagatgatttgatgacagaggccactacaggtgacaacatcagggaatttttactcagtttgcgatactttcgaattttcatagcactgtggaacattttcatgatgttttgtatgattgtgttatttggatcatgaatgtgttttactggatatcgcttattgtttgaaaattgaaaatgctggctctacacaccagaagatgttttctccccctattctttcagaagcaaagcatcatctagtccatatatctacagaaccagtcttctgtttgtaaataatgaaaactatataccagcaaatatgtcaacatgactaaacgaacactacaccaatagttcattattttaggaaaaaaatactatgccaggtttttaaaagaatgtagtaaacattttcttataataaaaaagctactttagtgcccaactagtagcccaaaacttctgatcagttcataaagtatccttaccataagaaggaattagatatgaaatatttctttccatggtgaaaatgtatttaattatttctgaaaaaacagggtttggtgaaatacaagacaggcccttttctgttctgaaggttctaaatgaaaagagatgctgtttgttaccatcatttttaatgagggtgatctgtaatggggtgaaaaacagacaggcagcataatacaagaggtgtgtaatttaaatggggtatctttatttttattttttttttgttatgatgaatggtgtaaacaagtataacgtctttctcttagcctcctctagagttatggagaaatgcatctgttctgccaagagagataaaaataacagacctttcagagcaaatggcgggagtgtatttaactcctaagcatcataaggattggttcatgggcaatatacactttgttcaacatgtggcaaataaatacagccttcatataaaatgtgttctgcccacttttaatttaataacatatagggaataatgtacaccctgttgtaaaaaataaagatattataaatcacagaggagtttcatgaccatatagaggccaaaggccaactgcttttatacagaacatgaaattctaggatgatttcttatatccttatatttttacaatatggggggttaatttacaaatttcagtatttcatatgacgcaaactttattactaagcgccactttataaggctgtcattttcagaatcttcctgtgcaaatcatggatttgcttttactctctcttccaaggggttgaagggaaagaacttcactgttcctctaacctcatgtagcccagcaacataggggaaaacagtataaaggaataaaactcccagcttttaccttgatatcttaaaagattgtagaagttgttgtccagcaacattagaggacccaggttaaggagacctaagaaacagctaataaaaatataaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MIGDLLLFGTLLVNAGAVLNFKLKKKESQGFGDDLMTEATTGDNIREFLLSLRYFRIFIALWNIFMMFCMIVLFGS
Donor tissue: gastrula