ORFeome > MGC76139 – XORFeome 2.0

MGC76139 – XORFeome 2.0

General Information

Species: Xenopus tropicalis fibrillarin, mRNA (cDNA clone MGC:76139 IMAGE:5335178), complete cds
Gene Symbol: MGC76139
Gene ID: 394705
ORF gb_acc: MG132808
ORF ID: 10153

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC062511

Library Location

Plate ID: GDExt11002
Well Location: C01

EST Sequences

Clone: MGC:76139 IMAGE:5335178
Trimmed Sequence: ATGAGGCCAGGATTCAGCCCCAGAGGAGGCCGAGGTGGATACGGAGACAGAGGAGGCTTTGGAGACAGAGGAGGAGGTAGAGGAAGAGGAGGATTTCGTGGCCGCGGTGGAGGAGGTGACCGAGGAGGGTTCGGAGGCCGAGGAGGATTCGGAGGCCGAGGAGGATTTGGAGACCGAGGAGGATTCAGAGGGGGATTCAAGTCTCCGGGCAGAGGCGGCCCCCGAGGAGGACGCGGAGGAAGAGGCGGATTTGGAGCAGGAAGGAAAGTGATAGTCGAGCCACACAGACATGAAGGAATATTTATCTGCCGCGGGAAGGAAGACGCACTCGTGACCAAAAACCTTGTTCCTGGGGAATCTGTGTATGGGGAGAAGCGAATCTCTGTGGAGGATGGGGAAGTGAAGACGGAGTACAGAGCCTGGAACCCCTTCAGGTCGAAGATCGCGGCGGCCATTTTGGGAGGAGTGGATCAGATTCACATAAAGCCCGGCGCCAAAGTGCTGTATCTGGGAGCTGCATCTGGAACCACCGTCTCGCACGTCTCCGATGTTGTGGGCCCCGAAGGGCTGGTTTACGCCGTCGAGTTCTCCCACAGATCCGGCCGTGATCTCATCAACGTGGCAAAGAAACGGACAAACATCATTCCAGTGATCGAGGACGCCCGGCACCCACACAAGTACCGCATGTTAGTAGGAATGGTGGACGTTGTCTTTGCGGATGTGGCGCAGCCTGATCAGACCAGGATCGTCGCCCTCAACGCCCATAACTTCCTGAAGAACGGAGGCCATTTTGTCATATCCATCAAGGCAAACTGCATTGACTCCACGGCAGCCCCAGAGGCTGTTTTTGCTGCCGAAGTAAAGAAGATGCAACAAGAGAACATGAAGCCGCAGGAGCAGCTGACGCTGGAGCCGTATGAGCGAGATCACGCCGTGGTGGTCGGGATATACAGGCCGCCGGCCAAACAGAAGAAATGA
Full Trace Sequence: cagtgagagcggtcggagcagccatgaggccaggattcagccccagaggaggccgaggtggatacggagacagaggaggctttggagacagaggaggaggtagaggaagaggaggatttcgtggccgcggtggaggaggtgaccgaggagggttcggaggccgaggaggattcggaggccgaggaggatttggagaccgaggaggattcagagggggattcaagtctccgggcagaggcggcccccgaggaggacgcggaggaagaggcggatttggagcaggaaggaaagtgatagtcgagccacacagacatgaaggaatatttatctgccgcgggaaggaagacgcactcgtgaccaaaaaccttgttcctggggaatctgtgtatggggagaagcgaatctctgtggaggatggggaagtgaagacggagtacagagcctggaaccccttcaggtcgaagatcgcggcggccattttgggaggagtggatcagattcacataaagcccggcgccaaagtgctgtatctgggagctgcatctggaaccaccgtctcgcacgtctccgatgttgtgggccccgaagggctggtttacgccgtcgagttctcccacagatccggccgtgatctcatcaacgtggcaaagaaacggacaaacatcattccagtgatcgaggacgcccggcacccacacaagtaccgcatgttagtaggaatggtggacgttgtctttgcggatgtggcgcagcctgatcagaccaggatcgtcgccctcaacgcccataacttcctgaagaacggaggccattttgtcatatccatcaaggcaaactgcattgactccacggcagccccagaggctgtttttgctgccgaagtaaagaagatgcaacaagagaacatgaagccgcaggagcagctgacgctggagccgtatgagcgagatcacgccgtggtggtcgggatatacaggccgccggccaaacagaagaaatgatcaagactgaactgaagatccttgtaaaggactttactcggagaactttcccagccagagactgacattaatgggttaatggtgccgggatttgttaaccattgcaatgtacaggactgattttgtctgtggccttttataatgtgggggcaggggaggaactagtggccccctagctgtcatgagtggtaactacagttgctgcttatagtagccggggggccacagagttgccgtctctgcttcacctgaggccacagaccgttattttataggttttcttttttttttctaacaaagaacgaaacgattaatcgcctttatttagctgccccgccccttttccactgcccaatccccgcgctccagcacctcatactggcgaatggaggcaaaacagggccccgtggctccatccttagtgtgcgggtgggggggttggtttctgtgtttgctatttctatgctggaagtttctatgggaagcgcaaagaattatctttttatgttttgtaagaaagaggaaaaaattgatattgaaagacaaacgagagatggaaattctttattttaattaaagtgccagtgtgtgagaatttgaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MRPGFSPRGGRGGYGDRGGFGDRGGGRGRGGFRGRGGGGDRGGFGGRGGFGGRGGFGDRGGFRGGFKSPGRGGPRGGRGGRGGFGAGRKVIVEPHRHEGIFICRGKEDALVTKNLVPGESVYGEKRISVEDGEVKTEYRAWNPFRSKIAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDVVGPEGLVYAVEFSHRSGRDLINVAKKRTNIIPVIEDARHPHKYRMLVGMVDVVFADVAQPDQTRIVALNAHNFLKNGGHFVISIKANCIDSTAAPEAVFAAEVKKMQQENMKPQEQLTLEPYERDHAVVVGIYRPPAKQKK
Donor tissue: tailbud