ORFeome > MGC76140 – XORFeome 2.0

MGC76140 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC76140, mRNA (cDNA clone MGC:76140 IMAGE:5335186), complete cds
Gene Symbol: MGC76140
Gene ID: 394869
ORF gb_acc: MG132809
ORF ID: 10154

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC063914

Library Location

Plate ID: GDExt11002
Well Location: G01

EST Sequences

Clone: MGC:76140 IMAGE:5335186
Trimmed Sequence: ATGGCAAACTTTAACAAGGGACCAGCCTACGGCCTCTCAGCTGAGGTGAAAAACAAGATTGCACAGAAATATGACCCTCAAGTGGAAGAGGAACTGCGTCTTTGGATAGAAGAAGTGACTGGCATGATAATTGGCGAAAACTTTCAGCAAGGTTTGCGGGATGGTATTATTCTCTGCAATCTCATAAATAAACTGCAGCCTGGGTCAATCAAGAAAATTAATGAAGCAAAATTAAACTGGCATAAGTTGGAGAACATTGGGAACTTCATTAAGGCAATGCAAGACTATGGTATGAAGCCACATGATATTTTTGAAGCCAATGACCTGTTTGAGAATGGAAACATGACCCAAGTTCAAACCTCTTTGGTGTCTTTGGCTGGCTTGGCAAAGACAAGAGGATTTCATACATCAGTGGACATTGGGGTCAAATATGCTGAAAAACAGAAAAGACAGTTTGGTGATGAAAAGATGAAAGCTGGCCAAAGTGTAATAGGCTTACAGATGGGAACAAACAAATGTGCAAGTCAAGCTGGTATGACAGCCTATGGAACCAGAAGGCATCTTTATGACCCTAAAATGCAAACGGATAAACCATTTGACCAGACTACAATAAGCCTACAGATGGGAACAAACAAAGGAGCTAGCCAGGCTGGCATGCCTGCCCCAGGAACAAGAAGAGATATTTACGATCAGAAAGCAATATTACAGCCAGTGGATAACTCTACTATTTCACTGCAAATGGGAACCAATAAAGTTGCCTCTCAAAAAGGAATGAGTGTGTATGGCCTTGGGCGGCAAGTATACGATCCAAAGTACTGCGCTGCCCCCACAGAACCAATCATTCATAATGGAAGTCAAGGAACTGGAACAAATGGATCTGAAATCAGTGATAGTGATTACCAGGCTGAGTATCCTGATGAATATCAGGGAGAATACCCTGATGACTATCCTAGGGATTACCATGGCCAGTACAGTGACCAGGGAATAGATTATTAG
Full Trace Sequence: gtgcaggattgggtattaaatagttttgcgtgttgcgggcggaaagacatccgtgcaataatggcaaactttaacaagggaccagcctacggcctctcagctgaggtgaaaaacaagattgcacagaaatatgaccctcaagtggaagaggaactgcgtctttggatagaagaagtgactggcatgataattggcgaaaactttcagcaaggtttgcgggatggtattattctctgcaatctcataaataaactgcagcctgggtcaatcaagaaaattaatgaagcaaaattaaactggcataagttggagaacattgggaacttcattaaggcaatgcaagactatggtatgaagccacatgatatttttgaagccaatgacctgtttgagaatggaaacatgacccaagttcaaacctctttggtgtctttggctggcttggcaaagacaagaggatttcatacatcagtggacattggggtcaaatatgctgaaaaacagaaaagacagtttggtgatgaaaagatgaaagctggccaaagtgtaataggcttacagatgggaacaaacaaatgtgcaagtcaagctggtatgacagcctatggaaccagaaggcatctttatgaccctaaaatgcaaacggataaaccatttgaccagactacaataagcctacagatgggaacaaacaaaggagctagccaggctggcatgcctgccccaggaacaagaagagatatttacgatcagaaagcaatattacagccagtggataactctactatttcactgcaaatgggaaccaataaagttgcctctcaaaaaggaatgagtgtgtatggccttgggcggcaagtatacgatccaaagtactgcgctgcccccacagaaccaatcattcataatggaagtcaaggaactggaacaaatggatctgaaatcagtgatagtgattaccaggctgagtatcctgatgaatatcagggagaataccctgatgactatcctagggattaccatggccagtacagtgaccagggaatagattattagatgtatacaatgtattcggtattagttacttattttattcaattaaagccaagctagccttgtgtaatttacttgtcttccttaaacactactatgctttaataatgaaacaatttgccttatgtacattccttttccaccttttatctctagttgccttttagtgctaagatggatcttaatctacagcattaccaataatttcatatgaagtaacaaaggaatactgtgaataatgaaaggagcgtttgtacagtcagtcttctttgcaggactatgcatctgtgctatacatatcatgcagtgcataataggaccagagcagattcattcctccccccccccacccccactccttgtttttataatgtatgtcagtagtaactgataattatggtatagcaatataacttgtagctgtgtatggctttgattacatcttagatattttacatattcctttctgatagagatctgtctacaaaatcacttgcagcaaagcaggactaaaagcacatttctaggaaatggtttgtttgttggtatgggacatcctttaacccacctttggcaatactgggacaaaaacttccagcttctcttgcagaattaaccttttcccccgcagaactgcaaattgttttagcccccaaaacatttcccagtacagtggtggtggttttttttttttcttcattcttttggagacctaatagatagattgaaatagaggagaggtgccaaactgatgccaagtattcagtgatctgtttttggaaacagccaccatatgctttaattaaagcagatacaggggtcattcagtttctgtctgtctggctgcagaagtcattgagggttcaattgtaacttcttttatcatgaggagaatgaggccataatttctatcgcctctaaaacaaaagtcttagcccatttatgtctaaactagtactgactccagcgagagtgactatataagcatggctctaatgctactgtcaccagtacctcttcagtcttaatatactttttctgacttttctaccatagtgatcattttaatattatggaatggataatattgggcagatggtagatctgtttcttctcttcccgtgctgcttctgtaaagggattatgaaataggctgaacactaatctgctcctaatgctaatattaagttaaagggagcctgtataaagttttgggaccacgtggatgtcttaatttgtgctatcagcgggattgaaacattacgttgcagacagcttcgacaggattcttaaaaatggatatcccatttacatttttattgtcctgtgccatattgtacccacgtagatgtgcttacgttctttttatgtgtatttattgccacattctcagcataaactgatcccagtgtatttttttataaataaattttgatattttgttttcttgaccgctaaaaaaaaaaaaaaaaa
Translation: MANFNKGPAYGLSAEVKNKIAQKYDPQVEEELRLWIEEVTGMIIGENFQQGLRDGIILCNLINKLQPGSIKKINEAKLNWHKLENIGNFIKAMQDYGMKPHDIFEANDLFENGNMTQVQTSLVSLAGLAKTRGFHTSVDIGVKYAEKQKRQFGDEKMKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMPAPGTRRDIYDQKAILQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPIIHNGSQGTGTNGSEISDSDYQAEYPDEYQGEYPDDYPRDYHGQYSDQGIDY
Donor tissue: tailbud