ORFeome > MGC76162 – XORFeome 2.0

MGC76162 – XORFeome 2.0

General Information

Species: Xenopus tropicalis cyclin C, mRNA (cDNA clone MGC:76162 IMAGE:5335423), complete cds
Gene Symbol: MGC76162
Gene ID: 394762
ORF gb_acc: MG132757
ORF ID: 10061

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061613

Library Location

Plate ID: GDExt11001
Well Location: E05

EST Sequences

Clone: MGC:76162 IMAGE:5335423
Trimmed Sequence: ATGAACCATATATTGGAATGTGAATTCTACCTATTAGAATTAATGGATTGTTGCTTGATAGTATATCATCCCTATAGACCCTTGCTTCAGTACGTGCAGGACATGGGACAGGAAGATATGCTACTTCCACTAGCATGGAGGATAGTAAACGATACATACCGTACAGATCTATGCCTGCTATACCCACCATTTATGATTGCTCTTGCCTGTCTGCATGTAGCATGTGTTGTCCAACAGAAAGATGCACGCCAGTGGTTTGCTGAACTATCTGTGGATATGGAAAAGATTTTGGAAATAATTAGAGTTATCCTTAAACTATATGAACAGTGGAAGAACTTTGATGAGAGAAAGGAAATGGCTACTATTCTTAATAAAATGCCGAAACCCAAGCCTCCCCCTAACAGTGAAGGTGAACAAGGAACAAATGGAAGCCAAAGCTCTGGGTACAGTCAGTCTTGA
Full Trace Sequence: atctctacatttcggctttatagacgctagctgtgggttgttgtgacgttcttggcagcgtcacaagcagcggtccgctcatccttaggcggtgttcgtttggctcattgatggcggggaacttttggcagagctctcactatttgcaatggattttggacaaacaagacttattaaaagaacgacaaaaagacctaaaatttttaagtgaagaagaatattggaaattgcagatattttttacaaatgttatccaagctttaggagaacaccttaaattacgacaacaagtcattgccactgccactgtttattttaaaagattttatgccaggtattctttaaaaagtatagatcctgtattaatggcaccaacatgtgtgtttttggcatccaaagtagaggaatttggtgttgtttcaaacacaagattaatctctgctgctacctctgtgttaaaaactaggttttcatatgcatttccaaaggaatttccttacagaatgaaccatatattggaatgtgaattctacctattagaattaatggattgttgcttgatagtatatcatccctatagacccttgcttcagtacgtgcaggacatgggacaggaagatatgctacttccactagcatggaggatagtaaacgatacataccgtacagatctatgcctgctatacccaccatttatgattgctcttgcctgtctgcatgtagcatgtgttgtccaacagaaagatgcacgccagtggtttgctgaactatctgtggatatggaaaagattttggaaataattagagttatccttaaactatatgaacagtggaagaactttgatgagagaaaggaaatggctactattcttaataaaatgccgaaacccaagcctccccctaacagtgaaggtgaacaaggaacaaatggaagccaaagctctgggtacagtcagtcttgacattttcctgaattccattagaggaccaagctggatcaaggttttgcccctgttaagaagccagaggctcccttttagcaaagcatcctgcaaaataagaggatttcttcatgttacagacacttttttcaagtctttattgttgaaaatctgtgtattttgcacagaacacaacgagcttctgatttggctcaaagaaaactgatcacaaaaatgttggaatctcacaaatacaaagaatgcattactcaatagtactgcaattaaaagacttcacaatctctttgcttatgctagttttctcttttccttaacccccccatcgaaatatttaattgtaaatgttttaacaagaataaaaacttattgaggtttgctactgttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILNKMPKPKPPPNSEGEQGTNGSQSSGYSQS
Donor tissue: tailbud