ORFeome > MGC76214 – XORFeome 2.0

MGC76214 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC76214, mRNA (cDNA clone MGC:76214 IMAGE:5336212), complete cds
Gene Symbol: MGC76214
Gene ID: 394799
ORF gb_acc: MG132812
ORF ID: 10157

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC063219

Library Location

Plate ID: GDExt11002
Well Location: H02

EST Sequences

Clone: MGC:76214 IMAGE:5336212
Trimmed Sequence: ATGGCGACCAGCGGCTGCATGAAAGTCACCAAGTACTTCCTGTTCCTGTTCAACCTCCTGTTCTTTATTCTGGGCGCTGTGATCCTAGGATTTGGAATATGGATACTGGTGGACAAAACCAGCTTTATAGCGGTCCTGCAGACCTCCTCTTCGTATCTCAGAACCGGCTCCTACATACTGATCGCCGTGGGGGGTTTCACGATGGTGATGGGATTCCTGGGCTGCTTGGGGGCAGTGAATGAGATCCGTTGCCTGTTGGGGCTGTATTTTTCCTTCCTGCTGATTATCCTGATTGCCCAAGTTGCAGCCGGAATTCTGATTTACTTACAGAGAGATACGCTCAAGACTGAGATGTCCTCCATAATCCATGAACTGATTGTCACTTATGACTATGAGGATGGAAAGAACACAAGCGCCGAGACCACCTGGGATTATATCCAGACAAATCTCCGTTGCTGCGGTTGGACTAACTATCAGAACTGGACTGCCAACACTGTGGTCCAGAACTCCACCAATCAGTATCCTTGCTCTTGTATGAAGAACCAGAGTTCTCCCAACGGCTTCTGCCAATACAATGGTACCGTGGAGTCCGCTGTGTATCAAACGGGCTGCATGCAGGGAGTGGAGAGCTGGCTACAGGATAACCTTGGCATCATTCTGGGCGTCTGCGTGGGAGTAGCAGTCATTGAGCTCCTGGGTCTCATTCTTTCCATGTGCCTGTGCCGCAGCATTCAAAGCGAAGACTACACCAAAGTCCCCAAATACTGA
Full Trace Sequence: ctcagaggagcagcagggagtgcggggagtgctggtaccgggacactgcgggctgggaagcgggatctgcctactaacagcctgggatcgggatctacagtccaacagccggagtctgggaccagggatctacttctctgcctgcgttttgggatcaggaccctcctacaatcagcagcttgcgatccggacttacctgcgtcacacagcgacccccagaacctaagacaaaatggcgaccagcggctgcatgaaagtcaccaagtacttcctgttcctgttcaacctcctgttctttattctgggcgctgtgatcctaggatttggaatatggatactggtggacaaaaccagctttatagcggtcctgcagacctcctcttcgtatctcagaaccggctcctacatactgatcgccgtggggggtttcacgatggtgatgggattcctgggctgcttgggggcagtgaatgagatccgttgcctgttggggctgtatttttccttcctgctgattatcctgattgcccaagttgcagccggaattctgatttacttacagagagatacgctcaagactgagatgtcctccataatccatgaactgattgtcacttatgactatgaggatggaaagaacacaagcgccgagaccacctgggattatatccagacaaatctccgttgctgcggttggactaactatcagaactggactgccaacactgtggtccagaactccaccaatcagtatccttgctcttgtatgaagaaccagagttctcccaacggcttctgccaatacaatggtaccgtggagtccgctgtgtatcaaacgggctgcatgcagggagtggagagctggctacaggataaccttggcatcattctgggcgtctgcgtgggagtagcagtcattgagctcctgggtctcattctttccatgtgcctgtgccgcagcattcaaagcgaagactacaccaaagtccccaaatactgagaataagctgtacccctgtaaccctcagcatccccttggaagggattcgccaggtggtcccccaaaaaagccaccatgtatatatagatgccccctccacaaggacttaatagacacatattggggtttttttctgtttttttgtacccctgtactaggtatttttgatccgttgcaccaagtgtcttaaaaccccgccccccccagctaggataaaggcaaagtagaaagtagtatttttgttttggggcacaagggggaacaatgtataaatatatataaatatgtgatatagggggggaggaccagacccttactgaatagatacttttatttctgtaaaaaaaagaacaaaaaaaaatatttagttgtgtctgtaaataaattggttgcccttagtaacgttaatttgctgctggtgtaggctgggctatcagtatgcagagaatacccccccgggtgggcaaactcttgtacagacaggggcaggatcaagtggaattcctgtatactcgtcagaggttcgtttaaaggcaaagtaatggagcgatattgataaatgtgatattttataacattcacggatttagggttttgttttttttatagcttgatagaatttaatcattgaagtaaattttctttgttcttattggttgtaatatttacttcctgtttgtggactgaaccctgcccattgagggggggagggatttgttggcacaatgatggtgtttatttttagagaagagtagggggcagaaaagcctccggaaacatggaaactgctttccccaaagtcatagggaagtcctgctaaataagacaatggacccttatgggataagacacatgagagactccgaactcctttggattcgtcttgtttgccacattcccatgatacctggaagaatcatactttatggaggtgtgagcataaggggttaagcgtttgagatctgggggtcacttggattcaattgccaatggcaagcgtcccggcacggcaccagacagaaactgccattttattgtgcccccttatgtctaaataattccacagtgggggacccccaattgcataagcagaactgatgttttatgtaacgcgtgtaatttcataattaaagggttcagcattgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MATSGCMKVTKYFLFLFNLLFFILGAVILGFGIWILVDKTSFIAVLQTSSSYLRTGSYILIAVGGFTMVMGFLGCLGAVNEIRCLLGLYFSFLLIILIAQVAAGILIYLQRDTLKTEMSSIIHELIVTYDYEDGKNTSAETTWDYIQTNLRCCGWTNYQNWTANTVVQNSTNQYPCSCMKNQSSPNGFCQYNGTVESAVYQTGCMQGVESWLQDNLGIILGVCVGVAVIELLGLILSMCLCRSIQSEDYTKVPKY
Donor tissue: tailbud