ORFeome > MGC76232 – XORFeome 2.0

MGC76232 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC76232, mRNA (cDNA clone MGC:76232 IMAGE:5336576), complete cds
Gene Symbol: MGC76232
Gene ID: 394935
ORF gb_acc: MG132803
ORF ID: 10141

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC063926

Library Location

Plate ID: GDExt11002
Well Location: B01

EST Sequences

Clone: MGC:76232 IMAGE:5336576
Trimmed Sequence: ATGGTACCGGTGATGCTTGTGGTGGGGCTCGGCATTGGGGCATATATACTCATCTATTTCAACTTGATTAGAGGAAGGCAATGCCGGAGCGACGCCAGCCTGAAGGGCAAGACTGTCATAGTGACGGGAGCGAATGTTGGCATTGGGAAAATGACAGCACTGGACATGGCTAAGAGGGGAGCGCGCGTTATCCTGGCGTGTCGGGTCAAAGAGACAGGAGAGGCTGCTGCCTATGACATAAGAAAGCTCTCGGGAAACAATCAGGTGGTTTTCATGAAACTTGATCTGGCCAGCCTAGAGTCAGTCAGGTCCTTCTGCAGAGCATTCCTCAGTAGTGAGCCTCGCCTGGACATACTTATCAACAACGCAGGTCTCAGTGGCTTCGGAAAGACTGCAGAAGGATATAACATTGTATTTGGGGTCAACCACCTTGGACATTTCCTCCTGACTTCCTTGCTTCTGGACCGACTCAAACAGAGCACCCCTAGCCGCATTGTGGTTTTAGCATCCTATGCCCACGAATGGGGAAAGATTGATTTCAATAAGATCAGTGTCCCATCAGAACATGTGAAAGACACACTTCAGTCATACTGTGACAGCAAGCTGTGCAATGTCCTCTTTGCTCGGGAGCTCGCCAACAGATTGCAGGGGACCAGCGTGACTTGTTACTCCGTTCATCCAGGAACTGTACACACAAACCTCGCACGCAGCTTGCCAAGCTGGATAAAAGTACTTATTGAACCAGTTTCTTGGCTCTTTCTCCGTACACCCATGAATGGAGCACAAACCTCCATATACTGTGCTGTACAAGAGGGCATTGAAATGTACAGTGGTCGCTACTTTGACAATTGCCAGGTTAGACAGGTAAAGCCTCACGCTCGGGACGACGCTGTGGCCAAGAAGCTCTGGGAAGTTAGTGAGAGGATGACCGGATTGGCCAGCTGA
Full Trace Sequence: gcgcggtgtctggggcagccatggtaccggtgatgcttgtggtggggctcggcattggggcatatatactcatctatttcaacttgattagaggaaggcaatgccggagcgacgccagcctgaagggcaagactgtcatagtgacgggagcgaatgttggcattgggaaaatgacagcactggacatggctaagaggggagcgcgcgttatcctggcgtgtcgggtcaaagagacaggagaggctgctgcctatgacataagaaagctctcgggaaacaatcaggtggttttcatgaaacttgatctggccagcctagagtcagtcaggtccttctgcagagcattcctcagtagtgagcctcgcctggacatacttatcaacaacgcaggtctcagtggcttcggaaagactgcagaaggatataacattgtatttggggtcaaccaccttggacatttcctcctgacttccttgcttctggaccgactcaaacagagcacccctagccgcattgtggttttagcatcctatgcccacgaatggggaaagattgatttcaataagatcagtgtcccatcagaacatgtgaaagacacacttcagtcatactgtgacagcaagctgtgcaatgtcctctttgctcgggagctcgccaacagattgcaggggaccagcgtgacttgttactccgttcatccaggaactgtacacacaaacctcgcacgcagcttgccaagctggataaaagtacttattgaaccagtttcttggctctttctccgtacacccatgaatggagcacaaacctccatatactgtgctgtacaagagggcattgaaatgtacagtggtcgctactttgacaattgccaggttagacaggtaaagcctcacgctcgggacgacgctgtggccaagaagctctgggaagttagtgagaggatgaccggattggccagctgaattctctcatcaagtgcagcaatctctaaaaagtataatctacctttaactaagaagaggtatctactgtttatgcattccagatatagggaacaccagtgggggttaagatgttggggaattctagataccctgactttatgtacaaaagagaacatacaagtcaaactattaagctgcccatacatgcaccgatgatatcgtttgtacgatattaggtgtgtgtatggcaagtcggcgaggcgactgatattgcagaagactgtggatatcggtcgactcgccgatcaggcgggttaaaagattttaaccaggtgccattaaagacacctgagcaaaatctacttttagggctgaatcgccagaaaaaatcctgttgtttctacctccatatctggcgattcatccctgaatgtctgtggagagtgggaacgatctttcatgtgaccatcgaaaatcgccacgtgtggtcacctttagtgctggtagaaaaaactgtacaactactcaatatgagataaacttaccacccccccaggttgatatttcttttcagtccctctctttaattgccagtgatctcaactagttgcagattgttctaatctacatcatgatatcatcagcaactacccctttaaagggacagtaacaccaaagagtgtatagaagtagttactatataatgtaatgctgccctgtactggtacaattggtgtgttttccttagaaggactactatagtttatataataaagctgctgtgtagctacgggggcagccatttacaggagaaagggcacaggttacttagcagataacagataaaaccccattatattctacaaagcttatctgttatctgctatgtgcctgtgcctgtgccttttctcctttttcccagcttcaatggctgcctccgtgttgacatagcagctcatttatataagctatagtggcgtttctgttgctaacttaccggttttaccaacgcagggcagccgtgcattatattttaattactttaaaacactttcattttttggtgttactgttcctttaatcattcgacaaaaatacacactctgatacctaagcccaaagtagacttttgcaccataggatattataaaagttgctgcgacttttacaaaggggataccatgaggcagctcacagggggagcaaaaacatttttaaccaagttctgttaattttttgttgtagaaatcacttgacattcctattaatatgtggatgtgaattatggatttgtggataaactgtttccttataaggaaataaacaaacttccgccttactctaaaataaaaggtttaaattctgaaaaaaaaaaaaaaaaaaa
Translation: MVPVMLVVGLGIGAYILIYFNLIRGRQCRSDASLKGKTVIVTGANVGIGKMTALDMAKRGARVILACRVKETGEAAAYDIRKLSGNNQVVFMKLDLASLESVRSFCRAFLSSEPRLDILINNAGLSGFGKTAEGYNIVFGVNHLGHFLLTSLLLDRLKQSTPSRIVVLASYAHEWGKIDFNKISVPSEHVKDTLQSYCDSKLCNVLFARELANRLQGTSVTCYSVHPGTVHTNLARSLPSWIKVLIEPVSWLFLRTPMNGAQTSIYCAVQEGIEMYSGRYFDNCQVRQVKPHARDDAVAKKLWEVSERMTGLAS
Donor tissue: tailbud