ORFeome > MGC76309 – XORFeome 2.0

MGC76309 – XORFeome 2.0

General Information

Species: Xenopus tropicalis electron-transfer-flavoprotein, beta polypeptide, mRNA (cDNA clone MGC:76309 IMAGE:5379820), complete cds
Gene Symbol: MGC76309
Gene ID: 394759
ORF gb_acc: MG132821
ORF ID: 10169

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061629

Library Location

Plate ID: GDExt11002
Well Location: E10

EST Sequences

Clone: MGC:76309 IMAGE:5379820
Trimmed Sequence: ATGGCGCTGCGAGCTTTAGTTGGTGTCAAGAGGGTCATAGACTATGCCGTGAAGGTGCGGGTGAAGCCTGATAAGACCGGGGTGGTCACTGATGGAGTAAAGCACTCTATGAATCCTTTCTGTGAGATTGCGGTGGAAGAAGCAGTCAGGCTGAAGGAGAAGAAGATTGTCAGTGAAATCATCGCCGTAAGCTGCGGCCCACAGCAATGCCAGGAGACCATCCGAACAGCTTTGGCCATGGGAGCCGACCGAGGAATACACGTTGAAGTGGCTGCTAAGGACGCAGAGAGCCTCGGGCCATTCCAGGTCTCCAAGATCATGGCAGCACTGGCAAAAAAAGAAAATGTTAACCTGGTGCTGATGGGGAAACAGGCCATTGACGATGACTGTAATCAGACCGGACAGATGACCGCAGCTCTGCTTGACTGGCCTCAGGGGACATTTGCTTCAGAAGTGAAAGTGGAAGGAGAGAAGTTGACAGTAGTGCGAGAAGTAGACGGGGGTCTCGAGACCATCAGCGTGAAACTCCCGGCAGTCGTCACGGCTGACTTGCGACTGAACGAGCCGCGTTACGCCACTCTTCCCAATATCATGAAAGCCAAAAAGAAGAAAATCGAGACGGTGAAACCCTCGGATTTGGGAGTGGACATCACAAGCCGTATCCGCGTTTTAAGCGTGGAGGATCCCCCCCAAAGACTAGCCGGCGTTAAAGTAGAAACTGTACAGGACCTCGTATCCAAGTTGAAGGAAAGCGGGCGAATATGA
Full Trace Sequence: ctgaaacatggcgctgcgagctttagttggtgtcaagagggtcatagactatgccgtgaaggtgcgggtgaagcctgataagaccggggtggtcactgatggagtaaagcactctatgaatcctttctgtgagattgcggtggaagaagcagtcaggctgaaggagaagaagattgtcagtgaaatcatcgccgtaagctgcggcccacagcaatgccaggagaccatccgaacagctttggccatgggagccgaccgaggaatacacgttgaagtggctgctaaggacgcagagagcctcgggccattccaggtctccaagatcatggcagcactggcaaaaaaagaaaatgttaacctggtgctgatggggaaacaggccattgacgatgactgtaatcagaccggacagatgaccgcagctctgcttgactggcctcaggggacatttgcttcagaagtgaaagtggaaggagagaagttgacagtagtgcgagaagtagacgggggtctcgagaccatcagcgtgaaactcccggcagtcgtcacggctgacttgcgactgaacgagccgcgttacgccactcttcccaatatcatgaaagccaaaaagaagaaaatcgagacggtgaaaccctcggatttgggagtggacatcacaagccgtatccgcgttttaagcgtggaggatcccccccaaagactagccggcgttaaagtagaaactgtacaggacctcgtatccaagttgaaggaaagcgggcgaatatgatgtggcttctctgcttctagaggttaattgctctgcggcggattcctggggtgcagggtttgactccgcctggctctgccgtcccgttacctcccggtgccttccctacgcactgccggacacccgaccctgattgtacaatggagaatggagacgagtggacgagagcaacaatcactgtaattaatcttgtgtctagtaataaaatttttcgcctttgtacatcctgaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MALRALVGVKRVIDYAVKVRVKPDKTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKIVSEIIAVSCGPQQCQETIRTALAMGADRGIHVEVAAKDAESLGPFQVSKIMAALAKKENVNLVLMGKQAIDDDCNQTGQMTAALLDWPQGTFASEVKVEGEKLTVVREVDGGLETISVKLPAVVTADLRLNEPRYATLPNIMKAKKKKIETVKPSDLGVDITSRIRVLSVEDPPQRLAGVKVETVQDLVSKLKESGRI
Donor tissue: tadpole