ORFeome > MGC76319 – XORFeome 2.0

MGC76319 – XORFeome 2.0

General Information

Species: Xenopus tropicalis 40S ribosomal protein S6, mRNA (cDNA clone MGC:76319 IMAGE:5380258), complete cds
Gene Symbol: MGC76319
Gene ID: 394725
ORF gb_acc: MG132893
ORF ID: 10257

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061437

Library Location

Plate ID: GDExt11003
Well Location: G02

EST Sequences

Clone: MGC:76319 IMAGE:5380258
Trimmed Sequence: ATGAAGCTTAACATCGCCAATCCCCACACGGGTATGCAAAAGGTCATCGAATGCGATGACGAATTGAAGTTGCGTGCTTTCTATGAAAAGCGCATGACCCAAGAAGTCGATGGTGAACACTTGGGCGAAGAATTCAAGGGCTTCGTCTTCAAGATCTCCGGTGGTAACGACAAGCAAGGTTTCCCAATGAAGCAAGGTGTCTTGACCAACGGCCGTGCCCGTCTCCTTTTGAGCAAGGGCAAGTCTTGCTACCGTCCACGCCGAAAGGGTGAACGCAAGCGCAAGTCTGTACGCGGTTGCATCGTTGGCCCAGATCTCTCTGTGCTCAACTTGGTTGTTGTCAAGGCTGGTGATGCTGAAGTACCAGGTTTGACCGATGGCCACATCCCACGTCGTTTGGGACCAAAGCGTGCTTCCAACATCCGCAAGTTGTTCAACTTGAGCAAGGAAGACGATGTACGCAAGTACGTCATCCGTCGTAAGTTCGACTCCAAGACTGGCAAGAAGAACGACAAGGCCCCAAAGATCCAACGTTTGGTAACTCCACGCACCTTGCACCACAAGGCCCAAATTGCTGCCAAGAAGTTGCAACAACGCGAAAAGGTCAAGCGTGATGCCGCCGAATACTCCCGTCTCTACACTCAGCGTGTTAAGGAGCAGAAGGAACGTCGTGCCTCCGAAATCGCCAAGCGCCGCAGCAGCCGCAAGGCTTCTGAAGTCAAGGCTGCTGCCGTCAAGAAGTAA
Full Trace Sequence: cgaacgtaaactcaccaacatgaagcttaacatcgccaatccccacacgggtatgcaaaaggtcatcgaatgcgatgacgaattgaagttgcgtgctttctatgaaaagcgcatgacccaagaagtcgatggtgaacacttgggcgaagaattcaagggcttcgtcttcaagatctccggtggtaacgacaagcaaggtttcccaatgaagcaaggtgtcttgaccaacggccgtgcccgtctccttttgagcaagggcaagtcttgctaccgtccacgccgaaagggtgaacgcaagcgcaagtctgtacgcggttgcatcgttggcccagatctctctgtgctcaacttggttgttgtcaaggctggtgatgctgaagtaccaggtttgaccgatggccacatcccacgtcgtttgggaccaaagcgtgcttccaacatccgcaagttgttcaacttgagcaaggaagacgatgtacgcaagtacgtcatccgtcgtaagttcgactccaagactggcaagaagaacgacaaggccccaaagatccaacgtttggtaactccacgcaccttgcaccacaaggcccaaattgctgccaagaagttgcaacaacgcgaaaaggtcaagcgtgatgccgccgaatactcccgtctctacactcagcgtgttaaggagcagaaggaacgtcgtgcctccgaaatcgccaagcgccgcagcagccgcaaggcttctgaagtcaaggctgctgccgtcaagaagtaaacgcgcaggcgatcttctaacgggttggtggacatgttggacaagcaaatgtctccaccagctttttaagcttctgttaacaaaggtgacaaacgatattattccaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MKLNIANPHTGMQKVIECDDELKLRAFYEKRMTQEVDGEHLGEEFKGFVFKISGGNDKQGFPMKQGVLTNGRARLLLSKGKSCYRPRRKGERKRKSVRGCIVGPDLSVLNLVVVKAGDAEVPGLTDGHIPRRLGPKRASNIRKLFNLSKEDDVRKYVIRRKFDSKTGKKNDKAPKIQRLVTPRTLHHKAQIAAKKLQQREKVKRDAAEYSRLYTQRVKEQKERRASEIAKRRSSRKASEVKAAAVKK
Donor tissue: tadpole