ORFeome > MGC76320 – XORFeome 2.0

MGC76320 – XORFeome 2.0

General Information

Species: Xenopus tropicalis 40S ribosomal protein S4, mRNA (cDNA clone MGC:76320 IMAGE:5380284), complete cds
Gene Symbol: MGC76320
Gene ID: 394507
ORF gb_acc: MG132894
ORF ID: 10258

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC059771

Library Location

Plate ID: GDExt11003
Well Location: G03

EST Sequences

Clone: MGC:76320 IMAGE:5380284
Trimmed Sequence: ATGGCTCGCGGACCGAAGAAGCATTTGAAGCGCGTTGCTGCGCCCAAACATTGGATGTTGGACAAGCTGACTGGTGTCTTTGCTCCTCGTCCATCCACTGGTCCCCACAAGCTCCGTGAGTGTCTGCCCCTGATCATCTTCCTTAGGAACCGACTTAAGTATGCATTGACTGGGGATGAGGTGAAGAAGATCTGCATGCAGCGCTTTATTAAAATTGATGGCAAGGTCCGAACAGACATCACATATCCTGCCGGCTTTATGGATGTCATCAGCATTGAGAAGACTGGTGAACACTTCCGTCTGGTTTATGATACCAAGGGCCGATTTGCAGTGCATAGAATTACAGCTGAAGAGGCCAAGTACAAGTTGTGCAAGGTGAGGAAGACATGGGTGGGAACCAAAGGCATTCCTCATCTGGTTACCCACGATGCACGCACAATCCGCTACCCTGATCCTTTAATAAAGGTCAATGACACCATCCAGATTGACCTGGAAACTGGCAAGATCACAGACTTCATTAAGTTTGATACTGGTAACCTTTGCATGGTGACTGGAGGAGCCAACTTGGGGCGAATTGGTGTCATCACCAACAGAGAGAGGCACCCAGGCTCATTCGATGTGGTCCATGTCAAGGATGCAAATGGCAACAGCTTTGCCACCAGGCTATCAAACATTTTTGTCATTGGCAAAGGCAACAAACCCTGGATCTCTTTGCCCCGTGGAAAGGGTATCCGTCTCACCATTGCTGAGGAGAGAGACAAGAGACTGGCAGCCAAACAGAGCAGTGGTTGA
Full Trace Sequence: cgcagccatggctcgcggaccgaagaagcatttgaagcgcgttgctgcgcccaaacattggatgttggacaagctgactggtgtctttgctcctcgtccatccactggtccccacaagctccgtgagtgtctgcccctgatcatcttccttaggaaccgacttaagtatgcattgactggggatgaggtgaagaagatctgcatgcagcgctttattaaaattgatggcaaggtccgaacagacatcacatatcctgccggctttatggatgtcatcagcattgagaagactggtgaacacttccgtctggtttatgataccaagggccgatttgcagtgcatagaattacagctgaagaggccaagtacaagttgtgcaaggtgaggaagacatgggtgggaaccaaaggcattcctcatctggttacccacgatgcacgcacaatccgctaccctgatcctttaataaaggtcaatgacaccatccagattgacctggaaactggcaagatcacagacttcattaagtttgatactggtaacctttgcatggtgactggaggagccaacttggggcgaattggtgtcatcaccaacagagagaggcacccaggctcattcgatgtggtccatgtcaaggatgcaaatggcaacagctttgccaccaggctatcaaacatttttgtcattggcaaaggcaacaaaccctggatctctttgccccgtggaaagggtatccgtctcaccattgctgaggagagagacaagagactggcagccaaacagagcagtggttgagctctacacatcttactttaaaataaaaaaaatctttattgataaaaaaaaaaaaaaaa
Translation: MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDEVKKICMQRFIKIDGKVRTDITYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITAEEAKYKLCKVRKTWVGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGRIGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGKGNKPWISLPRGKGIRLTIAEERDKRLAAKQSSG
Donor tissue: tadpole