ORFeome > MGC76322 – XORFeome 2.0

MGC76322 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC76322, mRNA (cDNA clone MGC:76322 IMAGE:5380322), complete cds
Gene Symbol: MGC76322
Gene ID: 394559
ORF gb_acc: MG132891
ORF ID: 10255

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061439

Library Location

Plate ID: GDExt11002
Well Location: F12

EST Sequences

Clone: MGC:76322 IMAGE:5380322
Trimmed Sequence: ATGGACGTGTTTTTGATGATCCGCCACCACAAGACCACCATATTTACAGATGCCAAGGAAAGTACCACAGTATATGAACTAAAAAGGATTGTTGAGGGAATCTTAAAGAGACCTCCTGAAGATCAGAAACTGTATAAGGACGACCAGGTACTTGATGACAACAAGACCCTCGGAGACTGTGGCTTCACCAGCCAAACCGCTAGGCCCCAAGCTCCTGCCACAGTGGGTCTGGCATTCCGCAGCTCAGGAGACTCCTTTGAGCCGCTCCGGGTGGATCCCTTCTCCAGCCCGCCGGAACTGCCAGATGTAATGAAGCCACAGGAAACGAGCGGGAGCGCCAACGAGCAAGCCGTGCAGTAG
Full Trace Sequence: ggtcggtctttgtcttgtcgctgtactccccgggacggacgggcggacaccgccgggatggacgtgtttttgatgatccgccaccacaagaccaccatatttacagatgccaaggaaagtaccacagtatatgaactaaaaaggattgttgagggaatcttaaagagacctcctgaagatcagaaactgtataaggacgaccaggtacttgatgacaacaagaccctcggagactgtggcttcaccagccaaaccgctaggccccaagctcctgccacagtgggtctggcattccgcagctcaggagactcctttgagccgctccgggtggatcccttctccagcccgccggaactgccagatgtaatgaagccacaggaaacgagcgggagcgccaacgagcaagccgtgcagtagagcctgggagatggcgtttgtatccattagactccacccactctcgtctccatgccgggggggtgggggtggaactcagtgctttgcaatctttgtggtccctccaacaagcgaagggagtaatatttcttaaccctgacagctcacacccactaccccgccccccttaccttgttgtacaaagtgaccccgcccttaagttccaagcagtctcccatggggcgaccattcagtccccccactcctattttttcaatcttccatttcttctgctttatttcccccctcccccttctccacagatcctatttgtttgtttttggggtgggcattttggttttgattttgttctattttattttttaaacacaataaatttttttttttttgcctgtgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MDVFLMIRHHKTTIFTDAKESTTVYELKRIVEGILKRPPEDQKLYKDDQVLDDNKTLGDCGFTSQTARPQAPATVGLAFRSSGDSFEPLRVDPFSSPPELPDVMKPQETSGSANEQAVQ
Donor tissue: tadpole