ORFeome > MGC76324 – XORFeome 2.0

MGC76324 – XORFeome 2.0

General Information

Species: Xenopus tropicalis myosin alkali light chain 6, smooth muscle form, mRNA (cDNA clone MGC:76324 IMAGE:5380398), complete cds
Gene Symbol: MGC76324
Gene ID: 394742
ORF gb_acc: MG132887
ORF ID: 10251

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061440

Library Location

Plate ID: GDExt11002
Well Location: G09

EST Sequences

Clone: MGC:76324 IMAGE:5380398
Trimmed Sequence: ATGTGCGACTACTCCGACGACCAGATTGCCGACTACAAGGAGTCCTTCCAACTTTTTGACCGTGTCGGCGATGGCAAAATCCTCTTCGGCCAGTGTGGGGACGTCATGCGGGCACTGGGGCAGAACCCCACTAATGCTGAGGTGATGAAGGTTTTGGGAAACCCAAAGCCTGAAGACATGAACATCAAGACACTTGACTTCGAGCAATTCCTCCCCATGATGCAAACAGTTGCCAAGAACAGGGATGTACCTGGATTGGAGGACATCATAGAAGGGCTAAGAGTCTTCGACAAGGAGGGAAATGGCACAGTTATGGGCTCCGAGTTGCGTCATGTCCTGGTTTCCCTCGGAGAGAAGATGACAGATGATGAAGTAGAGACCCTTTTAAGTAATCATGAGGATGCTAATGGTTGCATTAATTATGAAGAACTTATCCGGGCGATATTGAACGGCTGA
Full Trace Sequence: cgcgtcaagatgtgcgactactccgacgaccagattgccgactacaaggagtccttccaactttttgaccgtgtcggcgatggcaaaatcctcttcggccagtgtggggacgtcatgcgggcactggggcagaaccccactaatgctgaggtgatgaaggttttgggaaacccaaagcctgaagacatgaacatcaagacacttgacttcgagcaattcctccccatgatgcaaacagttgccaagaacagggatgtacctggattggaggacatcatagaagggctaagagtcttcgacaaggagggaaatggcacagttatgggctccgagttgcgtcatgtcctggtttccctcggagagaagatgacagatgatgaagtagagacccttttaagtaatcatgaggatgctaatggttgcattaattatgaagaacttatccgggcgatattgaacggctgaagcttctcctttagtttacctctgcccagtggggatgaagtgtgggggggaagttagttagcaatttattcaagcccttcactagagaggaagacaggctatatagtaagtgccttttctgcttcctccttatcccatcagtcacccccttcttcttgcaagtggcaaaattcgtattcattttttctgtaacatcacaagggaggcccacagctacagcttaaatgaacatcggtagaaattgtggcaaaataatttttcatatcaccccccccccccccatgcttccttaatgctgtagtgtgcagagaaagataaattatttaaaatttctattttttcccctctccaacatcaaataaactgagtgactttttccaagaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MCDYSDDQIADYKESFQLFDRVGDGKILFGQCGDVMRALGQNPTNAEVMKVLGNPKPEDMNIKTLDFEQFLPMMQTVAKNRDVPGLEDIIEGLRVFDKEGNGTVMGSELRHVLVSLGEKMTDDEVETLLSNHEDANGCINYEELIRAILNG
Donor tissue: tadpole