ORFeome > MGC76324 – XORFeome 2.0

MGC76324 – XORFeome 2.0

General Information

Species: Xenopus tropicalis myosin alkali light chain 6, smooth muscle form, mRNA (cDNA clone MGC:79717 IMAGE:6981607), complete cds
Gene Symbol: MGC76324
Gene ID: 394742
ORF gb_acc: MG133725
ORF ID: 11290

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC079951

Library Location

Plate ID: GDExt11013
Well Location: A01

EST Sequences

Clone: MGC:79717 IMAGE:6981607
Trimmed Sequence: ATGTGCGACTACTCCGACGACCAGATTGCCGACTACAAGGAGTCCTTCCAACTTTTTGACCGTGTCGGCGATGGCAAAATCCTCTTCGGCCAGTGTGGGGACGTCATGCGGGCACTGGGGCAGAACCCCACTAATGCTGAGGTGATGAAGGTTTTGGGAAACCCAAAGCCTGAAGACATGAACATCAAGACACTTGACTTCGAGCAATTCCTCCCCATGATGCAAACAGTTGCCAAGAACAGGGATGTACCTGGATTGGAGGACATCATAGAAGGGCTAAGAGTCTTCGACAAGGAGGGAAATGGCACAGTTATGGGCTCCGAGTTGCGTCATGTCCTGGTTTCCCTCGGAGAGAAGATGACAGATGATGAAGTAGAGACCCTTTTAAGTAATCATGAGGATGCTAATGGTTGCATTAATTATGAAGAACTTATCCGGGCGATATTGAACGGCTGA
Full Trace Sequence: gacgcgtcaagatgtgcgactactccgacgaccagattgccgactacaaggagtccttccaactttttgaccgtgtcggcgatggcaaaatcctcttcggccagtgtggggacgtcatgcgggcactggggcagaaccccactaatgctgaggtgatgaaggttttgggaaacccaaagcctgaagacatgaacatcaagacacttgacttcgagcaattcctccccatgatgcaaacagttgccaagaacagggatgtacctggattggaggacatcatagaagggctaagagtcttcgacaaggagggaaatggcacagttatgggctccgagttgcgtcatgtcctggtttccctcggagagaagatgacagatgatgaagtagagacccttttaagtaatcatgaggatgctaatggttgcattaattatgaagaacttatccgggcgatattgaacggctgaagcttctcctttagtttacctctgcccagtggggatgaagtgtgggggggaagttagttagcaatttattcaagcccttcactagagaggaagacaggctatatagtaagtgccttttctgcttcctccttatcccatcagtcacccccttcttctcgcaagtggcaaaattcgtattcattttttctgtaacatcacaagggaggcccacagctacagcttaaatgaacatcggtagaaattgtggcaaaataatttttcatatcaccccccccccccatgcttccttaatgctgtagtgtgcagagaaagataaattatttcaaatttctattttttcccctatccaacatcaaataaactgagtgactttttccaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MCDYSDDQIADYKESFQLFDRVGDGKILFGQCGDVMRALGQNPTNAEVMKVLGNPKPEDMNIKTLDFEQFLPMMQTVAKNRDVPGLEDIIEGLRVFDKEGNGTVMGSELRHVLVSLGEKMTDDEVETLLSNHEDANGCINYEELIRAILNG
Donor tissue: tadpole