ORFeome > MGC76328 – XORFeome 2.0

MGC76328 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC76328, mRNA (cDNA clone MGC:76328 IMAGE:5380518), complete cds
Gene Symbol: MGC76328
Gene ID: 394613
ORF gb_acc: MG132973
ORF ID: 10350

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061443

Library Location

Plate ID: GDExt11003
Well Location: B11

EST Sequences

Clone: MGC:76328 IMAGE:5380518
Trimmed Sequence: ATGAGGGAGGAAATAGTGACCGGGGTGAACTACCTGAAGGCTCTGGCTTGCAGATTCCACCGCTTGGATCCCATGGTGGTGGAGGCATTTGGGGAGAGGCTGGTGGAGATTCTGTGCCGGAGATACACGGGGCACTGGTACCCAGAGAAGCCCATGAAGGGCCAGGCATACAGGTGTATCCGGATCAACAGGCATCAGACGGATGAGAGTATTGCGGAAGCCTGTGCCCTTTGTGGCATCTCATACACAGATTTGTCACTGCCAAAAGAGATAACTCTATGGATTGACCCCTATGAAGTGTCTTGCCGGCTGCGGGAGAAGAATCACCCGTTCACTGTGGCGAGCTTTGATCCCAGGGACAATCGCGTTTTGTCAACAAGTTTAGAGAGCAAGACCCCGGCCTCCCCGTCAGACAGCGGCATAGACTGCTCCAGCCCCGGCTTATCCTCATGGGTGGGCGACAGGGGAGAAGATATGGACAGCGGGAATGATAGCAGCAATGAAGAACTCACCCACATTTACTCAGAACAGGTGGCTTGGACCCCCGGTGGGGTTTGCCTAACTCCGACCACTACGTCCTTATACAGAACATCTTCCCCACTATGGATCCCCACGTGGAGAGCAGCAGACTATATGTACAACACCATGAATAGCACAGAGCCGGGCTTCTGGATGTAG
Full Trace Sequence: ctaccagcgcctcaccgggatcggaaccgctcagtctgtgaatatgaatgtttttgtgccgccggagatgagggaggaaatagtgaccggggtgaactacctgaaggctctggcttgcagattccaccgcttggatcccatggtggtggaggcatttggggagaggctggtggagattctgtgccggagatacacggggcactggtacccagagaagcccatgaagggccaggcatacaggtgtatccggatcaacaggcatcagacggatgagagtattgcggaagcctgtgccctttgtggcatctcatacacagatttgtcactgccaaaagagataactctatggattgacccctatgaagtgtcttgccggctgcgggagaagaatcacccgttcactgtggcgagctttgatcccagggacaatcgcgttttgtcaacaagtttagagagcaagaccccggcctccccgtcagacagcggcatagactgctccagccccggcttatcctcatgggtgggcgacaggggagaagatatggacagcgggaatgatagcagcaatgaagaactcacccacatttactcagaacaggtggcttggacccccggtggggtttgcctaactccgaccactacgtccttatacagaacatcttccccactatggatccccacgtggagagcagcagactatatgtacaacaccatgaatagcacagagccgggcttctggatgtagccatatgccacggaggaagtgcgccacttgctggacactcttagagaagacaccctacaagctcttcatgtaggacactgtgggaagagtagaggcccatagctgtacatggagggcaagaagagaagcaatgagagggaataaggactaacgattttaaccggtttctatcgggtggaagaattaatatattgtaagtgaacctgttccatggggggcagcactggtcccactatggcagttggcaccactttaataccaaccctaacctttcaaccactgccactacagagatcattctgcctcccccatttgttataatgacccatataactgtacttattatcatttaataatgctaagggctatgcattcacctacaatatataataatatacatatacagttgccacatgtggtacaagtcggtctgtatgcagatgtgtatagatgaagttcttctgctggaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MREEIVTGVNYLKALACRFHRLDPMVVEAFGERLVEILCRRYTGHWYPEKPMKGQAYRCIRINRHQTDESIAEACALCGISYTDLSLPKEITLWIDPYEVSCRLREKNHPFTVASFDPRDNRVLSTSLESKTPASPSDSGIDCSSPGLSSWVGDRGEDMDSGNDSSNEELTHIYSEQVAWTPGGVCLTPTTTSLYRTSSPLWIPTWRAADYMYNTMNSTEPGFWM
Donor tissue: tadpole