ORFeome > MGC76332 – XORFeome 2.0

MGC76332 – XORFeome 2.0

General Information

Species: Xenopus tropicalis signal peptidase complex (18kD), mRNA (cDNA clone MGC:76332 IMAGE:5380673), complete cds
Gene Symbol: MGC76332
Gene ID: 394740
ORF gb_acc: MG132971
ORF ID: 10347

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061447

Library Location

Plate ID: GDExt11003
Well Location: F08

EST Sequences

Clone: MGC:76332 IMAGE:5380673
Trimmed Sequence: ATGTTATCTATGGATTTTTTAGACGATGTCAGGAGAATGAATAAAAGACAGCTGTACTACCAGGTCTTAAACTTTGGTATGATCGTGTCTTCAGCTCTGATGATATGGAAGGGTCTGATGGTAATCACTGGTAGTGAAAGCCCTATTGTAGTTGTCTTGAGTGGCAGCATGGAGCCTGCATTCCATCGTGGGGATCTGCTTTTCTTGACCAACCGTGTAGATGACCCTATCAGAGTTGGGGAAATTGTGGTCTTTAGGATAGAGGGAAGAGAGATACCCATTGTACATCGTGTCCTAAAGATCCATGAAAAGGAAAATGGAGATATTAAGTTTCTGACCAAGGGAGACAACAATGCAGTGGATGATCGAGGCTTGTACAAACAGGGGCAGAACTGGCTAGAGAAAAAGGATGTTGTGGGAAGAGCCAGAGGATTTGTTCCTTATATTGGAATTGTAACTATCCTGATGAATGACTATCCGAAATTTAAGTATGCTGTTCTGTTCCTCTTAGGCTTGTTTGTCCTAGTACACCGGGAATGA
Full Trace Sequence: gtgctttgctgtcttctcttggcgccggtcacgctttggagcgaacatgttatctatggattttttagacgatgtcaggagaatgaataaaagacagctgtactaccaggtcttaaactttggtatgatcgtgtcttcagctctgatgatatggaagggtctgatggtaatcactggtagtgaaagccctattgtagttgtcttgagtggcagcatggagcctgcattccatcgtggggatctgcttttcttgaccaaccgtgtagatgaccctatcagagttggggaaattgtggtctttaggatagagggaagagagatacccattgtacatcgtgtcctaaagatccatgaaaaggaaaatggagatattaagtttctgaccaagggagacaacaatgcagtggatgatcgaggcttgtacaaacaggggcagaactggctagagaaaaaggatgttgtgggaagagccagaggatttgttccttatattggaattgtaactatcctgatgaatgactatccgaaatttaagtatgctgttctgttcctcttaggcttgtttgtcctagtacaccgggaatgagagtgccttcagttacagtaggcaccggagagactattcatggaaatcatctatcatttgcctgaatatgaaatgtaaaaggacaaaccttttctgactgtttcaacttttacatttggagagcagtatttcttttctacacataacaatctgtacatgcgtgtagccactcctggctacagaatggactgagtggatatagagcgttgaaacctgaccttctctagcactggtactctgcttctgctagcagaggttatgcattcgtatccgctttgctgtttgcttttcctttttttttctttattattttgtactttggatggacatttttttaatattaaaacaaaatgccaaagtttcagtgtttgtattttgaagcctgtgcacattattcggaagtgcctatcttggaatttgtgtatgtgcagtgtttttgcagtcacacagaataaactgtgatctggaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MLSMDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVDDPIRVGEIVVFRIEGREIPIVHRVLKIHEKENGDIKFLTKGDNNAVDDRGLYKQGQNWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE
Donor tissue: tadpole