ORFeome > MGC79546 – XORFeome 2.0

MGC79546 – XORFeome 2.0

General Information

Species: Xenopus tropicalis chromatin modifying protein 2A, mRNA (cDNA clone MGC:79546 IMAGE:6978247), complete cds
Gene Symbol: MGC79546
Gene ID: 448496
ORF gb_acc: MG133529
ORF ID: 11055

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC076657

Library Location

Plate ID: GDExt11010
Well Location: G06

EST Sequences

Clone: MGC:79546 IMAGE:6978247
Trimmed Sequence: ATGGAGTTCCTGTTTGGACGACGCAAGACCCCAGAAGAGATGCTGAGGCAAAATCAGCGAGCTCTCAACAAGGCTATGAGAGAAATGGATCGGGAGAGACAGAAACTAGAGCAACAAGAGAAGAAAATAATTGCGGATATTAAAAAAATGGCAAAACAAGGACAAATGGATGCAGTGAAAATCATGGCAAAAGATCTCGTACGCACTCGTCGTTATGTAAAGAAATTTATCATGATGCGGGCAAACATCCAGGCGGTTTCACTTAAAATTCAAACACTAAAGTCCAACAATTCTATGGCTCAAGCTATGAAAGGAGTAACGAAAGCCATGGCCACAATGAACAGACAGCTAAAGCTTCCCCAGATACAGAAAATAATGATGGAGTTTGAAAAGCAATCAGAAATTATGGACATGAAAGAAGAAATGATGAATGATGCCATTGATGATGCCATGGGTGATGAAGATGATGAGGAGGAAAGCGATGCTGTTGTATCTCAGGTCCTGGATGAGCTGGGCTTAACTCTGACCGATGAGCTGTCTAACCTCCCATCAACAGGGGGCTCCCTCAGTGTGGCTGGAGCAAAGAAAGGCGAACCCTCAGCGGCCTTGGCCGATGCAGATGCAGATTTAGAAGAGCGGCTGAACAACCTGCGACGGGACTAA
Full Trace Sequence: ctgacgtcacggactggacaaacaggaagtgagagagaaacagagactgctagttactaacgagagcagaccttagcaagcaaatatggagttcctgtttggacgacgcaagaccccagaagagatgctgaggcaaaatcagcgagctctcaacaaggctatgagagaaatggatcgggagagacagaaactagagcaacaagagaagaaaataattgcggatattaaaaaaatggcaaaacaaggacaaatggatgcagtgaaaatcatggcaaaagatctcgtacgcactcgtcgttatgtaaagaaatttatcatgatgcgggcaaacatccaggcggtttcacttaaaattcaaacactaaagtccaacaattctatggctcaagctatgaaaggagtaacgaaagccatggccacaatgaacagacagctaaagcttccccagatacagaaaataatgatggagtttgaaaagcaatcagaaattatggacatgaaagaagaaatgatgaatgatgccattgatgatgccatgggtgatgaagatgatgaggaggaaagcgatgctgttgtatctcaggtcctggatgagctgggcttaactctgaccgatgagctgtctaacctcccatcaacagggggctccctcagtgtggctggagcaaagaaaggcgaaccctcagcggccttggccgatgcagatgcagatttagaagagcggctgaacaacctgcgacgggactaatgactggaagcctgtgactcacggactcttgagtttcttatttttatctttcttctgtgtttgcgtgaggatataggttaaatggcaagcaaattgccattttccctgcaggtgagaatcaaacccaataaattgctcactgtggcaacttttttcaagttatgttcaagtatctgttatgtgagcagactgttttgaatcgtttcttgtgttcccagacttaacttgcacatagggaaatgctgagggtctttcccttgccgaaaaaaaaccaaaggatgtaattccctgttgtgttacaaaatgataaggagttacaggggaagaaacagttgtttttagtaatacaaatcccttgatcttctttaaaggagaactatataagcagggcaggaatgttgtacattatgttttattcttctgtaccagcccaaggcaaccacagccctttagcagggaagatctgtgccccccgaagcccccatcttcttttctgctgattcacttcacatgctctgtgctgctgtcacttacgtgagcttagggaccgactcacaatatactgtatatgcataatttaaatataagactaatttgtaaataatacagattattagtgcagtggcagctctgaaatgtaataatcagtcctgtagcatcaccctctatgacaatactcctaacaaattccagtatggtgccctcctgtgacacctttgaaggtctcagtctttactactacagagatgctggttcaataagttcagcatataaaagatatgttaatttttaaggttcagttctcctttaaaaaaggttgcacaattttctctttcccagttagatatatgtatggggtgtatattatttgaatgaatgtataaagttcattttattctaataaagcatatcataccttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MEFLFGRRKTPEEMLRQNQRALNKAMREMDRERQKLEQQEKKIIADIKKMAKQGQMDAVKIMAKDLVRTRRYVKKFIMMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMATMNRQLKLPQIQKIMMEFEKQSEIMDMKEEMMNDAIDDAMGDEDDEEESDAVVSQVLDELGLTLTDELSNLPSTGGSLSVAGAKKGEPSAALADADADLEERLNNLRRD
Donor tissue: tailbud